TB Genome Annotation Portal

Rv1564c (treX)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: glycogen debranching enzyme GlgX
  • REFSEQ: maltooligosyltrehalose synthase TreX
  • PATRIC: Glycogen debranching enzyme (EC 3.2.1.-)
  • TUBERCULIST: Probable maltooligosyltrehalose synthase TreX
  • NCBI: Probable maltooligosyltrehalose synthase TreX
  • updated information (H37Rv4):
    • gene name: treX
    • function:
    • reference:
• Type: Not Target
• Start: 1769436
• End: 1771601
• Operon:


• Trans-membrane region:
  
• Role: II.A.8 - Polysaccharides (cytoplasmic)
• GO terms:
  • GO:0016798 - hydrolase activity, acting on glycosyl bonds (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005980 - glycogen catabolic process (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds (Uniprot)
  • GO:0004133 - glycogen debranching enzyme activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GLYCOGEN[c] -> MALTODEXTRIN[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2VUY	51%	SULFOLOBUS SOLFATARICUS	Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius
  2VR5	51%	SULFOLOBUS SOLFATARICUS	Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose
  2VNC	51%	SULFOLOBUS SOLFATARICUS	Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus
  2WSK	45%	ESCHERICHIA COLI K-12	Crystal structure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12
  4OKD	38%	Chlamydomonas reinhardtii	Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose
  4J7R	38%	Chlamydomonas reinhardtii	Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1)

• Links to additional information on treX:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.391 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSSNNAGESDGTGPALPTVWPGNAYPLGATYDGAGTNFSLFSEIAEKVELCLIDEDGVESRIPLDEVDGYVWHAYLPNITPGQRYGFRVHGPFDPAAGHR
CDPSKLLLDPYGKSFHGDFTFGQALYSYDVNAVDPDSTPPMVDSLGHTMTSVVINPFFDWAYDRSPRTPYHETVIYEAHVKGMTQTHPSIPPELRGTYAG
LAHPVIIDHLNELNVTAVELMPVHQFLHDSRLLDLGLRNYWGYNTFGFFAPHHQYASTRQAGSAVAEFKTMVRSLHEAGIEVILDVVYNHTAEGNHLGPT
INFRGIDNTAYYRLMDHDLRFYKDFTGTGNSLNARHPHTLQLIMDSLRYWVIEMHVDGFRFDLASTLARELHDVDRLSAFFDLVQQDPVVSQVKLIAEPW
DVGEGGYQVGNFPGLWTEWNGKYRDTVRDYWRGEPATLGEFASRLTGSSDLYEATGRRPSASINFVTAHDGFTLNDLVSYNDKHNEANGENNRDGESYNR
SWNCGVEGPTDDPDILALRARQMRNMWATLMVSQGTPMIAHGDEIGRTQYGNNNVYCQDSELSWMDWSLVDKNADLLAFARKATTLRKNHKVFRRRRFFE
GEPIRSGDEVRDIAWLTPSGREMTHEDWGRGFDRCVAVFLNGEAITAPDARGERVVDDSFLLCFNAHDHDVEFVMPHDGYAQQWTGELDTNDPVGDIDLT
VTATDTFSVPARSLLVLRKTL

Additional Information