TB Genome Annotation Portal

Rv1473 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ATP-binding cassette subfamily F member 3
  • REFSEQ: macrolide ABC transporter ATP-binding protein
  • PATRIC: ABC transporter ATP-binding protein
  • TUBERCULIST: Probable macrolide-transport ATP-binding protein ABC transporter
  • NCBI: Probable macrolide-transport ATP-binding protein ABC transporter
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1660656
• End: 1662284
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0046677 - response to antibiotic (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3UX8	40%	Geobacillus	Crystal structure of UvrA
  3UWX	40%	Geobacillus	Crystal structure of UvrA-UvrB complex
  2R6F	40%	Geobacillus stearothermophilus	Crystal Structure of Bacillus stearothermophilus UvrA
  6N9L	39%	Thermotoga maritima	Crystal structure of T. maritima UvrA d117-399 with ADP
  3PIH	39%	Thermotoga maritima	T. maritima UvrA in complex with fluorescein-modified DNA
  5X41	36%	Rhodobacter capsulatus	3.5A resolution structure of a cobalt energy-coupling factor transporter using LCP method-CbiMQO
  5X3X	36%	Rhodobacter capsulatus	2.8A resolution structure of a cobalt energy-coupling factor transporter-CbiMQO
  5X40	35%	Rhodobacter capsulatus	Structure of a CbiO dimer bound with AMPPCP

• Links to additional information on Rv1473:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.04 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VITATDLEVRAGARILLAPDGPDLRVQPGDRIGLVGRNGAGKTTTLRILAGEVEPYAGSVTRAGEIGYLPQDPKVGDLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADEDERDRAIRRYGQLEERFVALGGYGAESEAGRICASLGLPERVLTQRLRTLSGGQRRRVELARILFAASESGAGNSTTLLLDEPTNHLD
ADSLGWLRDFLRLHTGGLVVISHNVDLVADVVNKVWFLDAVRGQVDVYNMGWQRYVDARATDEQRRIRERANAERKAAALRAQAAKLGAKATKAVAAQNM
LRRADRMMAALDEERVADKVARIKFPTPAACGRTPLVANGLGKTYGSLEVFTGVDLAIDRGSRVVILGLNGAGKTTLLRLLAGVEQPDTGVLEPGYGLRI
GYFAQEHDTLDNDATVWENVRHAAPDAGEQDLRGLLGAFMFTGPQLEQPAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASREQVLDALRSYRG
AVVLVTHDPGAAAALGPQRVVLLPDGTEDYWSDEYRDLIELA

Additional Information