TB Genome Annotation Portal

Rv1445c (devB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 6-phosphogluconolactonase
  • REFSEQ: 6-phosphogluconolactonase
  • PATRIC: 6-phosphogluconolactonase (EC 3.1.1.31) eukaryotic type
  • TUBERCULIST: Probable 6-phosphogluconolactonase DevB (6PGL)
  • NCBI: Probable 6-phosphogluconolactonase DevB (6PGL)
  • updated information (H37Rv4):
    • gene name: devB
    • function:
    • reference:
• Type: Not Target
• Start: 1623714
• End: 1624457
• Operon:


• Trans-membrane region:
  
• Role: I.B.5 - Pentose phosphate pathway
• GO terms:
  • GO:0017057 - 6-phosphogluconolactonase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0009051 - pentose-phosphate shunt, oxidative branch (Uniprot)
  • GO:0006098 - pentose-phosphate shunt (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • D6PGL[c] -> D6PGC[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3ico, 3ico
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3ICO	99%	Mycobacterium tuberculosis	Crystal structure of 6-phosphogluconolactonase from Mycobacterium tuberculosis
  4TM8	66%	Mycobacterium smegmatis	Crystal structure of 6-phosphogluconolactonase from Mycobacterium smegmatis N131D mutant
  4TM7	66%	Mycobacterium smegmatis	Crystal structure of 6-phosphogluconolactonase from Mycobacterium smegmatis N131D mutant soaked with CuSO4
  3TX2	66%	Mycobacterium abscessus	Structure of a Probable 6-phosphogluconolactonase from Mycobacterium abscessus
  3OC6	66%	Mycobacterium smegmatis	Crystal structure of 6-phosphogluconolactonase from mycobacterium smegmatis, apo form
  6VYE	36%	Trypanosoma cruzi	6-phosphogluconolactonase from Trypanosoma cruzi
  3EB9	35%	Trypanosoma brucei	Crystal structure of 6-phosphogluconolactonase from trypanosoma brucei complexed with citrate
  3E7F	35%	Trypanosoma brucei	Crystal structure of 6-phosphogluconolactonase from Trypanosoma brucei complexed with 6-phosphogluconic acid
  2J0E	35%	TRYPANOSOMA BRUCEI	Three dimensional structure and catalytic mechanism of 6- phosphogluconolactonase from Trypanosoma brucei

• Links to additional information on devB:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.565 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSSSIEIFPDSDILVAAAGKRLVGAIGAAVAARGQALIVLTGGGNGIALLRYLSAQAQQIEWSKVHLFWGDERYVPEDDDERNLKQARRALLNHVDIPSN
QVHPMAASDGDFGGDLDAAALAYEQVLAASAAPGDPAPNFDVHLLGMGPEGHINSLFPHSPAVLESTRMVVAVDDSPKPPPRRITLTLPAIQRSREVWLL
VSGPGKADAVAAAIGGADPVSVPAAGAVGRQNTLWLLDRDAAAKLPS

Additional Information