Rv1441c (PE_PGRS26)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: triacylglycerol lipase
- REFSEQ: PE-PGRS family protein
- PATRIC: PE-PGRS FAMILY PROTEIN
- TUBERCULIST: PE-PGRS family protein PE_PGRS26
- NCBI: PE-PGRS family protein PE_PGRS26
- updated information (H37Rv4):
  - gene name: PE_PGRS26
  - function:
  - reference:
Type: Not Target
Start: 1618209
End: 1619684
Operon:

Trans-membrane region:
Role: IV.C.1.b - PE_PGRS subfamily
GO terms:
- GO:0009986 - cell surface (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on PE_PGRS26:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -0.487 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MSNVMVVPGMLSAAAADVASIGAALSAANGAAAPTTAGVLAAGADEVSAAIASLFSGYARDYQALSAQMARFHQQFVQALTASVGSYAAAEAANASPLQA
LEQQVLAAINAPTQTLLGRPLIGNGADGLPGQNGGAGGLLWGNGGNGGAGDAAHPNGGNGGDAGMFGNGGAGGAGYSPAAGTGAAGGAGGAGGAGGWLSG
NGGAGGNGGTGASGADGGGGLPPVPASPGGNGGGGDAGGAAGMFGTGGAGGTGGDGGAGGAGDSPNSGANGARGGDGGNGAAGGAGGRLFGNGGAGGNGG
TAGQGGDGGTALGAGGIGGDGGTGGAGGTGGTAGIGGSSAGAGGAGGDGGAGGTGGGSSMIGGKGGTGGNGGVGGTGGASALTIGNGSSAGAGGAGGAGG
TGGTGGYIESLDGKGQAGNGGNGGNGAAGGAGGGGTGAGGNGGAGGNGGDGGPSQGGGNPGFGGDGGTGGPGGVGVPDGIGGANGAQGKHG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 18 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.346000; 5 non-insertions in a row out of 18 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 18 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 18 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 18 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.45
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0047c (-) (Direct binding)
- Rv0081 (-) (Direct binding)
- Rv1353c (-) (Direct binding)
- Rv1404 (-) (Direct binding)
- Rv2324 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Citation	A comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins. PP. Singh, M. Parra et al. Microbiology (Reading, Engl.) 2008	priti.priety	TAS	18957600	Co-expression (Functional Linkage)
Interaction	Transcription Rv3286c	priti.priety	TAS		Co-expression (Functional Linkage) PP. Singh, M. Parra et al. A comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins. Microbiology (Reading, Engl.) 2008
Citation	A comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins. PP. Singh, M. Parra et al. Microbiology (Reading, Engl.) 2008	ashwinigbhat	TAS	18957600	Co-expression (Functional Linkage)
Interaction	Transcription Rv3286c	ashwinigbhat	TAS		Co-expression (Functional Linkage) PP. Singh, M. Parra et al. A comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins. Microbiology (Reading, Engl.) 2008
Interaction	RegulatedBy Rv3286c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv3286c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Citation	A comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins. PP. Singh, M. Parra et al. Microbiology (Reading, Engl.) 2008	jlew		18957600	More persistent. Overexpress in MS and infect macrophages and mice.
Citation	Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. EP. Williams, JH. Lee et al. J. Bacteriol. 2007	jlew		17384187	We found that overexpression of sigF resulted in the differential regulation of many cell wall-associated proteins, including members of the MmpL, PE, and PPE families.
Citation	Variable expression patterns of Mycobacterium tuberculosis PE_PGRS genes: evidence that PE_PGRS16 and PE_PGRS26 are inversely regulated in vivo. V. Dheenadhayalan, G. Delogu et al. J. Bacteriol. 2006	jlew		16672626	Significantly reduced under all of the in vitro conditions tested - inverse of PE_PGRS16. Evaluation of expression of 16 PE_PGRS genes present in Mycobacterium tuberculosis under various growth conditions

TB Genome Annotation Portal