Rv1422 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: FIG002813: hypothetical protein
- TUBERCULIST: Conserved hypothetical protein
- NCBI: hypothetical protein
- updated information (H37Rv4):
  - gene name: cuvA
  - function: carbon utilization and virulence protein A
  - reference: Mir (2014) PMID: 25047842
Type: Conditional
Start: 1596881
End: 1597909
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0005737 - cytoplasm (Uniprot)
- GO:0008930 - methylthioadenosine nucleosidase activity (FLUTE) (FLUTE Assigned!)
- GO:0016042 - lipid catabolic process (FLUTE) (FLUTE Assigned!)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2PPV	38%	Staphylococcus epidermidis	CRYSTAL STRUCTURE OF a protein belonging to the UPF0052 (SE_0549) FROM STAPHYLOCOCCUS EPIDERMIDIS ATCC 12228 AT 2.00 A RESOLUTION
2HZB	37%	Bacillus halodurans	X-Ray Crystal Structure of Protein BH3568 from Bacillus halodurans. Northeast Structural Genomics Consortium BhR60.
2P0Y	37%	Lactobacillus plantarum	Crystal structure of Q88YI3_LACPL from Lactobacillus plantarum. Northeast Structural Genomics Consortium target LpR6
2O2Z	37%	Bacillus halodurans	Crystal structure of a protein member of the upf0052 family (bh3568) from bacillus halodurans at 2.60 A resolution
2Q7X	36%	Streptococcus pneumoniae	Crystal structure of a putative phospho transferase (sp_1565) from streptococcus pneumoniae tigr4 at 2.00 A resolution

Links to additional information on Rv1422:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -0.476 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTDGIVALGGGHGLYATLSAARRLTPYVTAVVTVADDGGSSGRLRSELDVVPPGDLRMALAALASDSPHGRLWATILQHRFGGSGALAGHPIGNLMLAGL
SEVLADPVAALDELGRILGVKGRVLPMCPVALQIEADVSGLEADPRMFRLIRGQVAIATTPGKVRRVRLLPTDPPATRQAVDAIMAADLVVLGPGSWFTS
VIPHVLVPGLAAALRATSARRALVLNLVAEPGETAGFSVERHLHVLAQHAPGFTVHDIIIDAERVPSEREREQLRRTATMLQAEVHFADVARPGTPLHDP
GKLAAVLDGVCARDVGASEPPVAATQEIPIDGGRPRGDDAWR

(Nucleotide sequence available on KEGG)

Additional Information

CuvA - carbon utilization and virulence protein A

Mir M, Prisic S, Kang CM, Lun S, Guo H, Murry JP, Rubin EJ, Husson
RN. Mycobacterial gene cuvA is required for optimal nutrient
utilization and virulence. Infect Immun. 2014 Oct;82(10):4104-17. doi:
10.1128/IAI.02207-14. Epub 2014 Jul 21. Erratum in: Infect Immun. 2019
Jul 23;87(8): PMID: 25047842; PMCID: PMC4187881.

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 11 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.014250; 3 non-insertions in a row out of 11 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 11 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.868450; 6 non-insertions in a row out of 11 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.145150; 3 non-insertions in a row out of 11 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.91
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TB Genome Annotation Portal