Rv1400c (lipI)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: lipase lipH
- REFSEQ: lipase LipH
- PATRIC: Esterase/lipase
- TUBERCULIST: Probable lipase LipH
- NCBI: Probable lipase LipH
- updated information (H37Rv4):
  - gene name: lipI
  - function:
  - reference:
Type: Essential
Start: 1575834
End: 1576796
Operon:

Trans-membrane region:
Role: II.B.5 - Esterases and lipases
GO terms:
- GO:0034338 - short-chain carboxylesterase activity (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0009056 - catabolic process (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- PHOSPHATIDYLCHOLINE[c] -> DAG[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6K34	62%	Mycobacterium sp. YC-RL4	Crystal Structure of DphMB1
4YPV	42%	Parvibaculum	High-resolution structure of a metagenome-derived esterase Est8
6RS4	42%	Catharanthus roseus	Structure of tabersonine synthase - an alpha-beta hydrolase from Catharanthus roseus
2O7V	42%	Actinidia eriantha	Carboxylesterase AeCXE1 from Actinidia eriantha covalently inhibited by paraoxon
2O7R	42%	Actinidia eriantha	Plant carboxylesterase AeCXE1 from Actinidia eriantha with acyl adduct
1JJI	41%	Archaeoglobus fulgidus	The Crystal Structure of a Hyper-thermophilic Carboxylesterase from the Archaeon Archaeoglobus fulgidus
1U4N	41%	Alicyclobacillus acidocaldarius	Crystal Structure Analysis of the M211S/R215L EST2 mutant
1QZ3	41%	Alicyclobacillus acidocaldarius	CRYSTAL STRUCTURE OF MUTANT M211S/R215L OF CARBOXYLESTERASE EST2 COMPLEXED WITH HEXADECANESULFONATE
1EVQ	41%	Alicyclobacillus acidocaldarius	THE CRYSTAL STRUCTURE OF THE THERMOPHILIC CARBOXYLESTERASE EST2 FROM ALICYCLOBACILLUS ACIDOCALDARIUS
2HM7	41%	Alicyclobacillus acidocaldarius	Crystal Structure Analysis of the G84S EST2 mutant

Links to additional information on lipI:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.66 (from Jeremy Rock's lab)
- BioCyc
- Systems Biology

Amino Acid Sequence

MPSLDNTADEKPAIDPILLKVLDAVPFRLSIDDGIEAVRQRLRDLPRQPVHPELRVVDLAIDGPAGPIGTRIYWPPTCPDQAEAPVVLYFHGGGFVMGDL
DTHDGTCRQHAVGADAIVVSVDYRLAPEHPYPAAIEDAWAATRWVAEHGRQVGADLGRIAVAGDSAGGTIAAVIAQRARDMGGPPIVFQLLWYPSTLWDQ
SLPSLAENADAPILDVKAIAAFSRWYAGEIDLHNPPAPMAPGRAENLADLPPAYIAVAGYDPLRDDGIRYGELLAAAGVPVEVHNAQTLVHGYVGYAGVV
PAATEATNRGLVALRVVLHG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.199350; 5 non-insertions in a row out of 17 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 17 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 17 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.987850; 9 non-insertions in a row out of 18 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 18 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.33
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1353c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Citation	Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. JH. Lee, PC. Karakousis et al. J. Bacteriol. 2008	ashwinigbhat	IEP	17993538	Microarray analysis and in vitro transcription assay
Interaction	Regulatory Rv2710	ashwinigbhat	IEP		Microarray analysis and in vitro transcription assay JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Citation	A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. C. Deb, J. Daniel et al. J. Biol. Chem. 2006	ashwinigbhat	IEP	16354661	Microarray analysis and in vitro transcription assay
Interaction	Regulatory Rv2710	ashwinigbhat	IEP		Microarray analysis and in vitro transcription assay C. Deb, J. Daniel et al. A novel lipase belonging to the hormone-sensitive lipase family induced under starvation to utilize stored triacylglycerol in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. JH. Lee, PC. Karakousis et al. J. Bacteriol. 2008	priyadarshinipriyanka2001	NAS	17993538	Co-expression (Functional Linkage)
Interaction	Regulatory Rv2710	priyadarshinipriyanka2001	NAS		Co-expression (Functional Linkage) JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	RegulatedBy Rv2710	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008

TB Genome Annotation Portal