TB Genome Annotation Portal

Rv1379 (pyrR)

Amino Acid Sequence

MGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDDLMIKPPRPL
ASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.345000;
6 non-insertions in a row out of 7 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.675600;
6 non-insertions in a row out of 7 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.717200;
6 non-insertions in a row out of 7 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.623450;
6 non-insertions in a row out of 7 sites
Uncertain minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.612550;
6 non-insertions in a row out of 7 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1379 (pyrR)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv1380shahanup86IDAStructural Analysis
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    InteractionRegulatory Rv1381shahanup86IDAStructural Analysis
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationRegulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. authors,CJ. Fields,RL. Switzer J. Bacteriol. 2007shahanup86IDA17601781Structural Analysis
    InteractionRegulatory Rv1380shahanup86IDAStructural Analysis
    authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
    InteractionRegulatory Rv1381shahanup86IDAStructural Analysis
    authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
    InteractionRegulatory Rv1380priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
    InteractionRegulatory Rv1381shahanup86IEPCo-expression (Functional linkage)
    authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005shahanup86IDA15805589Spectrophotometric
    InteractionRegulatory Rv1380shahanup86IDASpectrophotometric
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    InteractionRegulatory Rv1381shahanup86IDASpectrophotometric
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationRegulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. authors,CJ. Fields,RL. Switzer J. Bacteriol. 2007shahanup86IDA17601781Spectrophotometric
    InteractionRegulatory Rv1380shahanup86IDASpectrophotometric
    authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
    InteractionRegulatory Rv1381shahanup86IDASpectrophotometric
    authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005shahanup86IDA15805589Structural Analysis
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005yamir.morenoISS15805589Protein structure based inferences. the regulation is infered after the observation of protein structure.
    InteractionRegulates Rv1385yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005yamir.morenoISS15805589Protein structure based inferences. the regulation is infered after the observation of protein structure.
    InteractionRegulates Rv1379yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    InteractionRegulatedBy Rv1379yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005yamir.morenoISS15805589Protein structure based inferences. the regulation is infered after the observation of protein structure.
    InteractionRegulates Rv1380yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005yamir.morenoISS15805589Protein structure based inferences. the regulation is infered after the observation of protein structure.
    InteractionRegulates Rv1381yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005yamir.morenoISS15805589Protein structure based inferences. the regulation is infered after the observation of protein structure.
    InteractionRegulates Rv1383yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    CitationStructure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. KA. Kantardjieff, C. Vasquez et al. Acta Crystallogr. D Biol. Crystallogr. 2005yamir.morenoISS15805589Protein structure based inferences. the regulation is infered after the observation of protein structure.
    InteractionRegulates Rv1384yamir.morenoISSProtein structure based inferences. the regulation is infered after the observation of protein structure.
    KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
    InteractionRegulatedBy Rv2720yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments