TB Genome Annotation Portal

Rv1365c (rsfA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: anti-anti-sigma factor
  • REFSEQ: anti-anti-sigma factor RSFA (anti-sigma factor antagonist) (regulator of sigma F A)
  • PATRIC: Anti-sigma factor antagonist
  • TUBERCULIST: Anti-anti-sigma factor RsfA (anti-sigma factor antagonist) (regulator of sigma F A)
  • NCBI: Anti-anti-sigma factor RsfA (anti-sigma factor antagonist) (regulator of sigma F A)
  • updated information (H37Rv4):
    • gene name: rsfA
    • function:
    • reference:
• Type: Not Target
• Start: 1537783
• End: 1538169
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0045893 - positive regulation of transcription, DNA-templated (Uniprot)
  • GO:0045152 - antisigma factor binding (Uniprot)
  • GO:0043856 - anti-sigma factor antagonist activity (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on rsfA:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.134 (from Jeremy Rock's lab)

Amino Acid Sequence

MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDR
AVARIIHACGYGDVLPVHPTTESALSAT

Additional Information