TB Genome Annotation Portal

Rv1349 (irtB)

Amino Acid Sequence

MIRTWIALVPNDHRARLIGFALLAFCSVVARAVGTVLLVPLMAALFGEAPQRAWLWLGWLSAATVAGWVLDAVTARIGIELGFAVLNHTQHDVADRLPVV
RLDWFTAENTATARQAIAATGPELVGLVVNLVTPLTSAILLPAVIALALLPISWQLGVAALAGVPLLLGALWASAAFARRADTAADKANTALTERIIEFA
RTQQALRAARRVEPARSLVGNALASQHTATMRLLGMQIPGQLLFSIASQLALIVLAGTTAALTITGTLTVPEAIALIVVMVRYLEPFTAVSELAPALEST
RATLGRIGSVLTAPVMVAGSGTWRDGAVVPRIEFDDVAFGYDGGSGPVLDGVSFCLQPGTTTAIVGPSGCGKSTILALIAGLHQPTRGRVLIDGTDVATL
DARAQQAVCSVVFQHPYLFHGTIRDNVFAADPGASDDQFAQAVRLARVDELIARLPDGANTIVGEAGSALSGGERQRVSIARALLKAAPVLLVDEATSAL
DAENEAAVVDALAADPRSRTRVIVAHRLASIRHADRVLFVDDGRVVEDGSISELLTAGGRFSQFWRQQHEAAEWQILAE
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1349/irtB, gene len: 1739 bp, num TA sites: 20
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifegrowth defect7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifegrowth defectBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeYES (LFC=-0.809)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.39)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.18 (0.39)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv1349/irtBRv2175c/-2.12
    Rv1349/irtBRv0445c/sigK1.67
    Rv1349/irtBRv3133c/dosR/devR1.5
    Rv1349/irtBRv3286c/sigF1.16
    Rv1349/irtBRv3765c/tcrX1.11
    Rv1349/irtBRv3058c/--1.05
    Rv1349/irtBRv3223c/sigH-1.07
    Rv1349/irtBRv0023/--1.15


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1349 (irtB)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2895cshahanup86IPICo-expression (Functional linkage)
    A. Farhana, S. Kumar et al. Mechanistic insights into a novel exporter-importer system of Mycobacterium tuberculosis unravel its role in trafficking of iron. PLoS ONE 2008
    CitationideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. GM. Rodriguez, MI. Voskuil et al. Infect. Immun. 2002shahanup86IEP12065475Co-expression (Functional linkage)
    InteractionRegulatory Rv2711shahanup86IEPCo-expression (Functional linkage)
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
    CitationMycobacterial Esx-3 is required for mycobactin-mediated iron acquisition. authors,MS. Siegrist,M. Unnikrishnan,MJ. McConnell,M. Borowsky,TY. Cheng,N. Siddiqi,SM. Fortune,DB. Moody,EJ. Rubin Proc. Natl. Acad. Sci. U.S.A. 2009shahanup86IEP19846780Co-expression (Functional linkage)
    InteractionRegulatory Rv0287shahanup86IEPCo-expression (Functional linkage)
    authors,MS. Siegrist,M. Unnikrishnan,MJ. McConnell,M. Borowsky,TY. Cheng,N. Siddiqi,SM. Fortune,DB. Moody,EJ. Rubin Mycobacterial Esx-3 is required for mycobactin-mediated iron acquisition. Proc. Natl. Acad. Sci. U.S.A. 2009
    InteractionRegulatory Rv0288shahanup86IEPCo-expression (Functional linkage)
    authors,MS. Siegrist,M. Unnikrishnan,MJ. McConnell,M. Borowsky,TY. Cheng,N. Siddiqi,SM. Fortune,DB. Moody,EJ. Rubin Mycobacterial Esx-3 is required for mycobactin-mediated iron acquisition. Proc. Natl. Acad. Sci. U.S.A. 2009
    InteractionPhysicalInteraction Rv1348shahanup86NASGene Neighborhood (Functional linkage)
    GM. Rodriguez & I. Smith Identification of an ABC transporter required for iron acquisition and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2006
    InteractionPhysicalInteraction Rv1348shahanup86NASGene Neighborhood (Functional linkage)
    MB. Ryndak,S. Wang,I. Smith,GM. Rodriguez The Mycobacterium tuberculosis high-affinity iron importer, IrtA, contains an FAD-binding domain. J. Bacteriol. 2010
    CitationIdentification of an ABC transporter required for iron acquisition and virulence in Mycobacterium tuberculosis. GM. Rodriguez & I. Smith J. Bacteriol. 2006shahanup86NAS16385031Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv1348shahanup86NASGene Neighborhood (Functional linkage)
    GM. Rodriguez & I. Smith Identification of an ABC transporter required for iron acquisition and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2006
    CitationMechanistic insights into a novel exporter-importer system of Mycobacterium tuberculosis unravel its role in trafficking of iron. A. Farhana, S. Kumar et al. PLoS ONE 2008shahanup86IPI18461140Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv2895cshahanup86IPIAffinity purification (Physical interaction)
    A. Farhana, S. Kumar et al. Mechanistic insights into a novel exporter-importer system of Mycobacterium tuberculosis unravel its role in trafficking of iron. PLoS ONE 2008
    InteractionRegulatedBy Rv2711yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

    Comments