TB Genome Annotation Portal

Rv1349 (irtB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: iron import ATP-binding/permease IrtB
  • REFSEQ: drugs-transport transmembrane ATP-binding protein ABC transporter
  • PATRIC: ABC transporter ATP-binding protein
  • TUBERCULIST: Iron-regulated transporter IrtB
  • NCBI: Iron-regulated transporter IrtB
  • updated information (H37Rv4):
    • gene name: irtB
    • function:
    • reference:
• Type: Essential
• Start: 1515623
• End: 1517362
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0075139 - response to host iron concentration (Uniprot)
  • GO:0055085 - transmembrane transport (Uniprot)
  • GO:0055072 - iron ion homeostasis (Uniprot)
  • GO:0052099 - acquisition by symbiont of nutrients from host via siderophores (Uniprot)
  • GO:0044718 - siderophore transmembrane transport (Uniprot)
  • GO:0042626 - ATPase activity, coupled to transmembrane movement of substances (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0033216 - ferric iron import (Uniprot)
  • GO:0033214 - iron assimilation by chelation and transport (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015891 - siderophore transport (Uniprot)
  • GO:0015343 - siderophore transmembrane transporter activity (Uniprot)
  • GO:0010106 - cellular response to iron ion starvation (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 0.48 ATP[c] + 0.48 TREHALOSEMONOMYCOLATE_40_CY_41_[c] -> 0.48 ADP[c] + 0.48 PI[c] + TREHALOSEMONOMYCOLATE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6TEJ	68%	Mycolicibacterium thermoresistibile	Structure of apo IrtAB devoid SID in complex with sybody Syb_NL5
  6A6N	45%	Cyanidioschyzon merolae strain 10D	Crystal structure of an inward-open apo state of the eukaryotic ABC multidrug transporter CmABCB1
  6A6M	45%	Cyanidioschyzon merolae strain 10D	Crystal structure of an outward-open nucleotide-bound state of the eukaryotic ABC multidrug transporter CmABCB1
  3WMG	45%	Cyanidioschyzon merolae	Crystal structure of an inward-facing eukaryotic ABC multidrug transporter G277V/A278V/A279V mutant in complex with an cyclic peptide inhibitor, aCAP
  3WMF	45%	Cyanidioschyzon merolae	Crystal structure of an inward-facing eukaryotic ABC multitrug transporter G277V/A278V/A279V mutant
  3WME	45%	Cyanidioschyzon merolae	Crystal structure of an inward-facing eukaryotic ABC multidrug transporter
  6TEJ	44%	Mycolicibacterium thermoresistibile	Structure of apo IrtAB devoid SID in complex with sybody Syb_NL5
  6VQU	44%	Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)	Structure of a bacterial Atm1-family ABC exporter
  6VQT	44%	Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)	Structure of a bacterial Atm1-family ABC exporter with MgADPVO4 bound
  6PAR	44%	Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)	Structure of a bacterial Atm1-family ABC exporter with MgAMPPNP bound

• Links to additional information on irtB:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.885 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MIRTWIALVPNDHRARLIGFALLAFCSVVARAVGTVLLVPLMAALFGEAPQRAWLWLGWLSAATVAGWVLDAVTARIGIELGFAVLNHTQHDVADRLPVV
RLDWFTAENTATARQAIAATGPELVGLVVNLVTPLTSAILLPAVIALALLPISWQLGVAALAGVPLLLGALWASAAFARRADTAADKANTALTERIIEFA
RTQQALRAARRVEPARSLVGNALASQHTATMRLLGMQIPGQLLFSIASQLALIVLAGTTAALTITGTLTVPEAIALIVVMVRYLEPFTAVSELAPALEST
RATLGRIGSVLTAPVMVAGSGTWRDGAVVPRIEFDDVAFGYDGGSGPVLDGVSFCLQPGTTTAIVGPSGCGKSTILALIAGLHQPTRGRVLIDGTDVATL
DARAQQAVCSVVFQHPYLFHGTIRDNVFAADPGASDDQFAQAVRLARVDELIARLPDGANTIVGEAGSALSGGERQRVSIARALLKAAPVLLVDEATSAL
DAENEAAVVDALAADPRSRTRVIVAHRLASIRHADRVLFVDDGRVVEDGSISELLTAGGRFSQFWRQQHEAAEWQILAE

Additional Information