TB Genome Annotation Portal

Rv1327c (glgE)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: glucanase glgE
  • REFSEQ: glucanase GLGE
  • PATRIC: Putative glucanase glgE (EC 3.2.1.-)
  • TUBERCULIST: Probable glucanase GlgE
  • NCBI: Probable glucanase GlgE
  • updated information (H37Rv4):
    • gene name: glgE
    • function:
    • reference:
• Type: Not Target
• Start: 1492320
• End: 1494425
• Operon:


• Trans-membrane region:
  
• Role: II.B.4 - Polysaccharides, lipopolysaccharides and phospholipids
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016758 - transferase activity, transferring hexosyl groups (Uniprot)
  • GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0005978 - glycogen biosynthetic process (Uniprot)
  • GO:0005977 - glycogen metabolic process (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • MLT1P[c] -> PI[c] + LINEAR-GLUCAN[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4U3C	99%	Mycobacterium tuberculosis	Docking Site of Maltohexaose in the Mtb GlgE
  4U33	99%	Mycobacterium tuberculosis	Structure of Mtb GlgE bound to maltose
  5CJ5	77%	Mycobacterium thermoresistibile ATCC 19527	Structure of Mycobacterium thermoresistibile GlgE APO form at 3.13A resolution
  5CIM	77%	Mycobacterium thermoresistibile ATCC 19527	Structure of Mycobacterium thermoresistibile GlgE in complex with maltose (cocrystallisation with maltose-1-phosphate) at 3.32A resolution
  5CGM	77%	Mycobacterium thermoresistibile ATCC 19527	Structure of Mycobacterium thermoresistibile GlgE in complex with maltose at 1.95A resolution
  5VT4	54%	Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)	Sco GlgEI-V279S in complex with a pyrolidene-based methyl-phosphonate compound
  5VSJ	54%	Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)	Sco GlgEI-V279S in complex with a pyrolidene-based ethyl-phosphonate compound
  4U31	54%	Streptomyces coelicolor	Sco GlgEI-V279S in Complex with maltose-C-phosphonate
  4U2Z	54%	Streptomyces coelicolor	X-ray crystal structure of an Sco GlgEI-V279S/1,2,2-trifluromaltose complex
  4U2Y	54%	Streptomyces coelicolor	Sco GlgEI-V279S in Complex with Reaction Intermediate Azasugar

• Links to additional information on glgE:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -8.952 (from Jeremy Rock's lab)

Amino Acid Sequence

VSGRAIGTETEWWVPGRVEIDDVAPVVSCGVYPAKAVVGEVVPVSAAVWREGHEAVAATLVVRYLGVRYPHLTDRPRARVLPTPSEPQQRVKPLLIPMTS
GQEPFVFHGQFTPDRVGLWTFRVDGWGDPIHTWRHGLIAKLDAGQGETELSNDLLVGAVLLERAATGVPRGLRDPLLAAAAALRTPGDPVTRTALALTPE
IEELLADYPLRDLVTRGEQFGVWVDRPLARFGAWYEMFPRSTGGWDDDGNPVHGTFATAAAELPRIAGMGFDVVYLPPIHPIGKVHRKGRNNSPTAAPTD
VGSPWAIGSDEGGHDTVHPSLGTIDDFDDFVSAARDLGMEVALDLALQCAPDHPWAREHRQWFTELPDGTIAYAENPPKKYQDIYPLNFDNDPEGLYDEV
LRVVQHWVNHGVKFFRVDNPHTKPPNFWAWLIAQVKTVDPDVLFLSEAFTPPARQYGLAKLGFTQSYSYFTWRTTKWELTEFGNQIAELADYRRPNLFVN
TPDILHAVLQHNGPGMFAIRAVLAATMSPAWGMYCGYELFEHRAVREGSEEYLDSEKYELRPRDFASALDQGRSLQPFITRLNIIRRLHPAFQQLRTIHF
HHVDNDALLAYSKFDPATGDCVLVVVTLNAFGPEEATLWLDMAALGMEDYDRFWVRDEITGEEYQWGQANYIRIDPARAVAHIINMPAVPYESRNTLLRR
R

Additional Information