TB Genome Annotation Portal

Rv1302 (rfe)

Amino Acid Sequence

VQYGLEVSSDVAGVAGGLLALSYRGAGVPLRELALVGLTAAIITYFATGPVRMLASRLGAVAYPRERDVHVTPTPRMGGLAMFLGIVGAVFLASQLPALT
RGFVYSTGMPAVLVAGAVIMGIGLIDDRWGLDALTKFAGQITAASVLVTMGVAWSVLYIPVGGVGTIVLDQASSILLTLALTVSIVNAMNFVDGLDGLAA
GLGLITALAICMFSVGLLRDHGGDVLYYPPAVISVVLAGACLGFLPHNFHRAKIFMGDSGSMLIGLMLAAASTTAAGPISQNAYGARDVFALLSPFLLVV
AVMFVPMLDLLLAIVRRTRAGRSAFSPDKMHLHHRLLQIGHSHRRVVLIIYLWVGIVAFGAASSIFFNPRDTAAVMLGAIVVAGVATLIPLLRRGDDYYD
PDLD
(Nucleotide sequence available on KEGG)

Additional Information

WecA.
Huzar et al (2017). N-Acetylglucosamine-1-Phosphate Transferase, WecA, as a Validated Drug Target in Mycobacterium tuberculosis. AAC. https://aac.asm.org/content/61/11/e01310-17

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1302/rfe, gene len: 1214 bp, num TA sites: 20
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.1)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.065)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.38)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)0.93 (0.22)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv1302/wecARv0757/phoP1.51
    Rv1302/wecARv3765c/tcrX1.04
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1302 (rfe)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:ACGAMT UDP-N-acetylglucosamine:undecaprenylphosphate N-acetylglucosamine -1-phosphate transferase - ISSnjamshidiISS|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
    CitationBiosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000njamshidiIPI|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    TermTBRXN:ACGAMT UDP-N-acetylglucosamine:undecaprenylphosphate N-acetylglucosamine -1-phosphate transferase - IPInjamshidiIPI|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
    CitationBiosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000njamshidiISS|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatedBy Rv3286cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    SymbolwecAmjacksonIMPGlcNAc-1-phosphate transferase
    NameGlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenylmjacksonIMPGlcNAc-1-phosphate transferase
    SymbolwecAmmcneilGlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenyl (complementation of an E. coli LPS mutant)
    authors,Y. Jin,Y. Xin,W. Zhang,Y. Ma Mycobacterium tuberculosis Rv1302 and Mycobacterium smegmatis MSMEG_4947 have WecA function and MSMEG_4947 is required for the growth of M. smegmatis. FEMS Microbiol. Lett. 2010
    CitationMycobacterium tuberculosis Rv1302 and Mycobacterium smegmatis MSMEG_4947 have WecA function and MSMEG_4947 is required for the growth of M. smegmatis. authors,Y. Jin,Y. Xin,W. Zhang,Y. Ma FEMS Microbiol. Lett. 2010mmcneil20637039GlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenyl (complementation of an E. coli LPS mutant)
    TermGO:0003975 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity - NRmmcneilNRGlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenyl (complementation of an E. coli LPS mutant)
    authors,Y. Jin,Y. Xin,W. Zhang,Y. Ma Mycobacterium tuberculosis Rv1302 and Mycobacterium smegmatis MSMEG_4947 have WecA function and MSMEG_4947 is required for the growth of M. smegmatis. FEMS Microbiol. Lett. 2010
    CitationBiosynthesis of the linkage region of the mycobacterial cell wall. authors,K. Mikusov,M. Mikus,GS. Besra,I. Hancock,PJ. Brennan J. Biol. Chem. 1996extern:JZUCKER8631826Assay of unpurified protein expressed in its native host
    TermEC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NRextern:JZUCKERNRAssay of unpurified protein expressed in its native host
    authors,K. Mikusov,M. Mikus,GS. Besra,I. Hancock,PJ. Brennan Biosynthesis of the linkage region of the mycobacterial cell wall. J. Biol. Chem. 1996

    Comments