TB Genome Annotation Portal

Rv1302 (rfe)

Amino Acid Sequence

VQYGLEVSSDVAGVAGGLLALSYRGAGVPLRELALVGLTAAIITYFATGPVRMLASRLGAVAYPRERDVHVTPTPRMGGLAMFLGIVGAVFLASQLPALT
RGFVYSTGMPAVLVAGAVIMGIGLIDDRWGLDALTKFAGQITAASVLVTMGVAWSVLYIPVGGVGTIVLDQASSILLTLALTVSIVNAMNFVDGLDGLAA
GLGLITALAICMFSVGLLRDHGGDVLYYPPAVISVVLAGACLGFLPHNFHRAKIFMGDSGSMLIGLMLAAASTTAAGPISQNAYGARDVFALLSPFLLVV
AVMFVPMLDLLLAIVRRTRAGRSAFSPDKMHLHHRLLQIGHSHRRVVLIIYLWVGIVAFGAASSIFFNPRDTAAVMLGAIVVAGVATLIPLLRRGDDYYD
PDLD
(Nucleotide sequence available on KEGG)

Additional Information

WecA.
Huzar et al (2017). N-Acetylglucosamine-1-Phosphate Transferase, WecA, as a Validated Drug Target in Mycobacterium tuberculosis. AAC. https://aac.asm.org/content/61/11/e01310-17

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.999950;
16 non-insertions in a row out of 19 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
16 non-insertions in a row out of 19 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
16 non-insertions in a row out of 19 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
16 non-insertions in a row out of 20 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
16 non-insertions in a row out of 20 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.84
Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.

    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.

    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv1302 (rfe)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:ACGAMT UDP-N-acetylglucosamine:undecaprenylphosphate N-acetylglucosamine -1-phosphate transferase - ISSnjamshidiISS|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
    CitationBiosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000njamshidiIPI|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    TermTBRXN:ACGAMT UDP-N-acetylglucosamine:undecaprenylphosphate N-acetylglucosamine -1-phosphate transferase - IPInjamshidiIPI|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
    CitationBiosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000njamshidiISS|10934214See PMID: 10934214, Text by Cole et al (Tuberculosis and the tubercle bacillus) chap 18.
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatedBy Rv3286cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    SymbolwecAmjacksonIMPGlcNAc-1-phosphate transferase
    NameGlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenylmjacksonIMPGlcNAc-1-phosphate transferase
    SymbolwecAmmcneilGlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenyl (complementation of an E. coli LPS mutant)
    authors,Y. Jin,Y. Xin,W. Zhang,Y. Ma Mycobacterium tuberculosis Rv1302 and Mycobacterium smegmatis MSMEG_4947 have WecA function and MSMEG_4947 is required for the growth of M. smegmatis. FEMS Microbiol. Lett. 2010
    CitationMycobacterium tuberculosis Rv1302 and Mycobacterium smegmatis MSMEG_4947 have WecA function and MSMEG_4947 is required for the growth of M. smegmatis. authors,Y. Jin,Y. Xin,W. Zhang,Y. Ma FEMS Microbiol. Lett. 2010mmcneil20637039GlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenyl (complementation of an E. coli LPS mutant)
    TermGO:0003975 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity - NRmmcneilNRGlcNAc-1-P transferase. Transfers GlcNAc-1-P to decaprenyl phosphate to make GlcNAc-P-P-decaprenyl (complementation of an E. coli LPS mutant)
    authors,Y. Jin,Y. Xin,W. Zhang,Y. Ma Mycobacterium tuberculosis Rv1302 and Mycobacterium smegmatis MSMEG_4947 have WecA function and MSMEG_4947 is required for the growth of M. smegmatis. FEMS Microbiol. Lett. 2010
    CitationBiosynthesis of the linkage region of the mycobacterial cell wall. authors,K. Mikusov,M. Mikus,GS. Besra,I. Hancock,PJ. Brennan J. Biol. Chem. 1996extern:JZUCKER8631826Assay of unpurified protein expressed in its native host
    TermEC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NRextern:JZUCKERNRAssay of unpurified protein expressed in its native host
    authors,K. Mikusov,M. Mikus,GS. Besra,I. Hancock,PJ. Brennan Biosynthesis of the linkage region of the mycobacterial cell wall. J. Biol. Chem. 1996

    Comments