TB Genome Annotation Portal

Rv1264 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: pH-sensitive adenylate cyclase
  • REFSEQ: adenylyl cyclase
  • PATRIC: Adenylate cyclase (EC 4.6.1.1)
  • TUBERCULIST: Adenylyl cyclase (ATP pyrophosphate-lyase) (adenylate cyclase)
  • NCBI: Adenylyl cyclase (ATP pyrophosphate-lyase) (adenylate cyclase)
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1411894
• End: 1413087
• Operon:


• Trans-membrane region:
  
• Role: IV.J - Cyclases
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0042803 - protein homodimerization activity (Uniprot)
  • GO:0035556 - intracellular signal transduction (Uniprot)
  • GO:0030818 - negative regulation of cAMP biosynthetic process (Uniprot)
  • GO:0030145 - manganese ion binding (Uniprot)
  • GO:0016849 - phosphorus-oxygen lyase activity (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009268 - response to pH (Uniprot)
  • GO:0009190 - cyclic nucleotide biosynthetic process (Uniprot)
  • GO:0008289 - lipid binding (Uniprot)
  • GO:0007165 - signal transduction (Uniprot)
  • GO:0006171 - cAMP biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004016 - adenylate cyclase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] -> PPI[c] + cAMP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2ev4, 2ev2, 2ev3, 1y10, 1y11, 2ev1
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1Y11	99%	Mycobacterium tuberculosis	Mycobacterial adenylyl cyclase Rv1264, holoenzyme, active state
  1Y10	99%	Mycobacterium tuberculosis	Mycobacterial adenylyl cyclase Rv1264, holoenzyme, inhibited state
  2EV4	99%	Mycobacterium tuberculosis	Structure of Rv1264N, the regulatory domain of the mycobacterial adenylyl cylcase Rv1264, with a salt precipitant
  2EV3	99%	Mycobacterium tuberculosis	Structure of Rv1264N, the regulatory domain of the mycobacterial adenylyl cylcase Rv1264, at pH 5.3
  2EV2	99%	Mycobacterium tuberculosis	Structure of Rv1264N, the regulatory domain of the mycobacterial adenylyl cylcase Rv1264, at pH 8.5
  2EV1	99%	Mycobacterium tuberculosis	Structure of Rv1264N, the regulatory domain of the mycobacterial adenylyl cylcase Rv1264, at pH 6.0

• Links to additional information on Rv1264:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.236 (from Jeremy Rock's lab)

Amino Acid Sequence

VTDHVREADDANIDDLLGDLGGTARAERAKLVEWLLEQGITPDEIRATNPPLLLATRHLVGDDGTYVSAREISENYGVDLELLQRVQRAVGLARVDDPDA
VVHMRADGEAAARAQRFVELGLNPDQVVLVVRVLAEGLSHAAEAMRYTALEAIMRPGATELDIAKGSQALVSQIVPLLGPMIQDMLFMQLRHMMETEAVN
AGERAAGKPLPGARQVTVAFADLVGFTQLGEVVSAEELGHLAGRLAGLARDLTAPPVWFIKTIGDAVMLVCPDPAPLLDTVLKLVEVVDTDNNFPRLRAG
VASGMAVSRAGDWFGSPVNVASRVTGVARPGAVLVADSVREALGDAPEADGFQWSFAGPRRLRGIRGDVRLFRVRRGATRTGSGGAAQDDDLAGSSP

Additional Information