TB Genome Annotation Portal

Rv1221 (sigE)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sigma-70 family RNA polymerase sigma factor
  • REFSEQ: RNA polymerase sigma factor SigE
  • PATRIC: RNA polymerase sigma-70 factor
  • TUBERCULIST: Alternative RNA polymerase sigma factor SigE
  • NCBI: Alternative RNA polymerase sigma factor SigE
  • updated information (H37Rv4):
    • gene name: sigE
    • function:
    • reference:
• Type: Not Target
• Start: 1364413
• End: 1365186
• Operon:


• Trans-membrane region:
  
• Role: II.A.7 - RNA synthesis, RNA modification and DNA transcription
• GO terms:
  • GO:2000142 - regulation of DNA-templated transcription, initiation (Uniprot)
  • GO:0090034 - regulation of chaperone-mediated protein complex assembly (Uniprot)
  • GO:0052572 - response to host immune response (Uniprot)
  • GO:0044119 - growth of symbiont in host cell (Uniprot)
  • GO:0042542 - response to hydrogen peroxide (Uniprot)
  • GO:0016987 - bacterial sigma factor activity (Uniprot)
  • GO:0009410 - response to xenobiotic stimulus (Uniprot)
  • GO:0009408 - response to heat (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006352 - DNA-templated transcription, initiation (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0003700 - DNA binding transcription factor activity (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6JCY	59%	Mycobacterium tuberculosis H37Rv	Mycobacterium tuberculosis RNA polymerase transcription initiation open complex with a chimeric ECF sigma factor sigH/E
  5FGM	51%	Streptomyces coelicolor	Streptomyces coelicolor SigR region 4
  2H27	51%	Escherichia coli K12	Crystal Structure of Escherichia coli SigmaE Region 4 Bound to its-35 Element DNA
  6JHE	45%	Bacillus subtilis (strain 168)	Crystal Structure of Bacillus subtilis SigW domain 4 in complexed with -35 element DNA
  5WUR	35%	Bacillus subtilis subsp. subtilis str. 168	Crystal structure of SigW in complex with its anti-sigma RsiW, an oxdized form
  5WUQ	35%	Bacillus subtilis subsp. subtilis str. 168	Crystal structure of SigW in complex with its anti-sigma RsiW, a zinc binding form

• Links to additional information on sigE:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.89 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSHPQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAY
RLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAA
VVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECAVHVNPVR

Additional Information