TB Genome Annotation Portal

Rv1164 (narI)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: respiratory nitrate reductase gamma subunit
  • REFSEQ: respiratory nitrate reductase subunit gamma NarI
  • PATRIC: Respiratory nitrate reductase gamma chain (EC 1.7.99.4)
  • TUBERCULIST: Probable respiratory nitrate reductase (gamma chain) NarI
  • NCBI: Probable respiratory nitrate reductase (gamma chain) NarI
  • updated information (H37Rv4):
    • gene name: narI
    • function:
    • reference:
• Type: Not Target
• Start: 1293406
• End: 1294146
• Operon:


• Trans-membrane region:
  
• Role: I.B.6.b - anaerobic
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0020037 - heme binding (Uniprot)
  • GO:0019645 - anaerobic electron transport chain (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0009325 - nitrate reductase complex (Uniprot)
  • GO:0009055 - electron transfer activity (Uniprot)
  • GO:0008940 - nitrate reductase activity (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • MKH2[c] + 0.001 MOLYBDENUM[c] + NO3[c] -> 2 H[c] + MK[c] + NO2[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on narI:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.58 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

LAVLDLVEIFWDAAPYVVVAIAVVGTWWRYRYDKFGWTTRSSQLYESRLLSIGSPMFHFGSLLVIMGHVMGLFIPDSWTRAFGMSDHLYHLQALLLGAPA
GFATLLGIGLLIYRRRIQTPVWLATTRNDKLMYLVLVCAIVAGLACTLMGATHEGDMHDYRRSVSVWFRSIWMLAPRGDLMAQATLYYQVHVLIALALFA
LWPFTRLVHAFSAPIAYLFRPYIVYRSREVAAKHELIGSAPRRRGW

Additional Information