Rv1164 (narI)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: respiratory nitrate reductase gamma subunit
REFSEQ: respiratory nitrate reductase subunit gamma NarI
PATRIC: Respiratory nitrate reductase gamma chain (EC 1.7.99.4)
TUBERCULIST: Probable respiratory nitrate reductase (gamma chain) NarI
NCBI: Probable respiratory nitrate reductase (gamma chain) NarI
updated information (H37Rv4):
gene name: narI
function:
reference:
Coordinates in H37Rv: 1293406 - 1294146
Gene length: 741 bp (with stop codon), 246 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.B.6.b - anaerobic
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on narI:
Amino Acid Sequence
LAVLDLVEIFWDAAPYVVVAIAVVGTWWRYRYDKFGWTTRSSQLYESRLLSIGSPMFHFGSLLVIMGHVMGLFIPDSWTRAFGMSDHLYHLQALLLGAPA
GFATLLGIGLLIYRRRIQTPVWLATTRNDKLMYLVLVCAIVAGLACTLMGATHEGDMHDYRRSVSVWFRSIWMLAPRGDLMAQATLYYQVHVLIALALFA
LWPFTRLVHAFSAPIAYLFRPYIVYRSREVAAKHELIGSAPRRRGW
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv1164/narI,
gene len: 740 bp, num TA sites: 19
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.32) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.456) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.29) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv1164: 0.456503322
lineage-specific pN/pS in L1: 0.505665218
lineage-specific pN/pS in L2: 0.554286873
lineage-specific pN/pS in L3: 0.677230202
lineage-specific pN/pS in L4: 0.366607283
Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods )
Moldova: 2,057 clinical isolates
global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
Moldova (2,057) global set (5,195)
under significant positive selection? NO NO
omega peak height (95%CI lower bound) 3.23 (0.95) 1.56 (0.55)
codons under selection
omega plots
genetic variants* link link
statistics at each codon link link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. M. Stermann, A. Bohrssen et al. J. Clin. Microbiol. 2003 njamshidi ISS 12843072 PMID: 12843072
Term TBRXN:NO3R2 Nitrate reductase (Menaquinol-8) - ISS njamshidi ISS 12843072 PMID: 12843072M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Citation Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. M. Stermann, A. Bohrssen et al. J. Clin. Microbiol. 2003 njamshidi IPI 12843072 PMID: 12843072
Term TBRXN:NO3R2 Nitrate reductase (Menaquinol-8) - IPI njamshidi IPI 12843072 PMID: 12843072M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Citation Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. M. Stermann, A. Bohrssen et al. J. Clin. Microbiol. 2003 njamshidi ISS 12843072 PMID: 12843072
Term TBRXN:NO3R1 Nitrate reductase (Ubiquinol-8) - ISS njamshidi ISS 12843072 PMID: 12843072M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Citation Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. M. Stermann, A. Bohrssen et al. J. Clin. Microbiol. 2003 njamshidi IPI 12843072 PMID: 12843072
Term TBRXN:NO3R1 Nitrate reductase (Ubiquinol-8) - IPI njamshidi IPI 12843072 PMID: 12843072M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1162 dreamsbeyondinfinity NAS Operon (Functional linkage)CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity NAS Operon (Functional linkage)CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1162 dreamsbeyondinfinity IDA Spectrophotometric AnalysisM. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity IDA Spectrophotometric AnalysisM. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Citation Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. M. Stermann, A. Bohrssen et al. J. Clin. Microbiol. 2003 dreamsbeyondinfinity NAS 12843072 Operon (Functional linkage)
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity NAS Operon (Functional linkage)M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1162 dreamsbeyondinfinity NAS Operon (Functional linkage)M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity NAS Operon (Functional linkage)M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Citation Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. CD. Sohaskey & LG. Wayne J. Bacteriol. 2003 dreamsbeyondinfinity NAS 14645286 Operon (Functional linkage)
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity NAS Operon (Functional linkage)CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity NAS Operon (Functional linkage)CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Citation Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. CD. Sohaskey & LG. Wayne J. Bacteriol. 2003 dreamsbeyondinfinity IDA 14645286 Spectrophotometric Analysis
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity IDA Spectrophotometric AnalysisCD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1162 dreamsbeyondinfinity IDA Spectrophotometric AnalysisCD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity IDA Spectrophotometric AnalysisCD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Citation Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. M. Stermann, A. Bohrssen et al. J. Clin. Microbiol. 2003 dreamsbeyondinfinity IDA 12843072 Spectrophotometric Analysis
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity IDA Spectrophotometric AnalysisM. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity IDA Spectrophotometric AnalysisM. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity NAS Operon (Functional linkage)M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1162 dreamsbeyondinfinity IDA Spectrophotometric AnalysisM. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1163 dreamsbeyondinfinity IDA Spectrophotometric AnalysisCD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity TAS Operon (Functional linkage)CD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1162 dreamsbeyondinfinity IDA Spectrophotometric AnalysisCD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity TAS Operon (Functional linkage)M. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity TAS Operon (Functional linkage)authors,JF. Ghiglione,L. Philippot,P. Normand,R. Lensi,P. Potier Disruption of narG, the gene encoding the catalytic subunit of respiratory nitrate reductase, also affects nitrite respiration in Pseudomonas fluorescens YT101. J. Bacteriol. 1999
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity IDA Spectrophotometric AnalysisCD. Sohaskey & LG. Wayne Role of narK2X and narGHJI in hypoxic upregulation of nitrate reduction by Mycobacterium tuberculosis. J. Bacteriol. 2003
Interaction PhysicalInteraction Rv1161 dreamsbeyondinfinity IDA Spectrophotometric AnalysisM. Stermann, A. Bohrssen et al. Polymorphic nucleotide within the promoter of nitrate reductase (NarGHJI) is specific for Mycobacterium tuberculosis. J. Clin. Microbiol. 2003