TB Genome Annotation Portal

Rv1161 (narG)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: nitrate reductase alpha subunit
  • REFSEQ: respiratory nitrate reductase subunit alpha NarG
  • PATRIC: Respiratory nitrate reductase alpha chain (EC 1.7.99.4)
  • TUBERCULIST: Respiratory nitrate reductase (alpha chain) NarG
  • NCBI: Respiratory nitrate reductase (alpha chain) NarG
  • updated information (H37Rv4):
    • gene name: narG
    • function:
    • reference:
• Type: Not Target
• Start: 1287328
• End: 1291026
• Operon:


• Trans-membrane region:
  
• Role: I.B.6.b - anaerobic
• GO terms:
  • GO:0071732 - cellular response to nitric oxide (Uniprot)
  • GO:0071249 - cellular response to nitrate (Uniprot)
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0051539 - 4 iron, 4 sulfur cluster binding (Uniprot)
  • GO:0051536 - iron-sulfur cluster binding (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0043602 - nitrate catabolic process (Uniprot)
  • GO:0043546 - molybdopterin cofactor binding (Uniprot)
  • GO:0042128 - nitrate assimilation (Uniprot)
  • GO:0042126 - nitrate metabolic process (Uniprot)
  • GO:0036294 - cellular response to decreased oxygen levels (Uniprot)
  • GO:0022900 - electron transport chain (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0009325 - nitrate reductase complex (Uniprot)
  • GO:0009055 - electron transfer activity (Uniprot)
  • GO:0008940 - nitrate reductase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • MKH2[c] + 0.001 MOLYBDENUM[c] + NO3[c] -> 2 H[c] + MK[c] + NO2[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3EGW	46%	Escherichia coli	The crystal structure of the NarGHI mutant NarH - C16A
  1Y5N	46%	Escherichia coli	The crystal structure of the NarGHI mutant NarI-K86A in complex with pentachlorophenol
  1Y5L	46%	Escherichia coli	The crystal structure of the NarGHI mutant NarI-H66Y
  1Y5I	46%	Escherichia coli	The crystal structure of the NarGHI mutant NarI-K86A
  1Y4Z	46%	Escherichia coli	The crystal structure of Nitrate Reductase A, NarGHI, in complex with the Q-site inhibitor pentachlorophenol
  1SIW	46%	Escherichia coli	Crystal structure of the apomolybdo-NarGHI
  1R27	46%	Escherichia coli	Crystal Structure of NarGH complex
  1Q16	46%	Escherichia coli	Crystal structure of Nitrate Reductase A, NarGHI, from Escherichia coli
  3IR7	46%	Escherichia coli K-12	Crystal structure of NarGHI mutant NarG-R94S
  3IR6	46%	Escherichia coli K-12	Crystal structure of NarGHI mutant NarG-H49S

• Links to additional information on narG:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.345 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VTVTPHVGGPLEELLERSGRFFTPGEFSADLRTVTRRGGREGDVFYRDRWSHDKVVRSTHGVNCTGSCSWKIYVKDGIITWETQQTDYPSVGPDRPEYEP
RGCPRGASFSWYSYSPTRVRYPYARGVLVEMYREAKTRLGDPVLAWADIQADPERRRRYQQARGKGGLVRVSWAEASEMVAAAHVHTIKTYGPDRVAGFS
PIPAMSMVSHAAGSRFVELIGGVMTSFYDWYADLPVASPQVFGDQTDVPESGDWWDASYLVMWGSNVPITRTPDAHWMAEARYRGAKVVVVSPDYADNTK
FADEWVRCAAGTDTALAMAMGHVILSECYVRNQVPFFVDYVRRYTDLPFLIKLEKRGDLLVPGKFLTAADIGEESENAAFKPALLDELTNTVVVPQGSLG
FRFGEDGVGKWNLDLGSVVPALSVEMDKAVNGDRSAELVTLPSFDTIDGHGETVSRGVPVRRAGKHLVCTVFDLMLAHYGVARAGLPGEWPTGYHDRTQQ
NTPAWQESITGVPAAQAIRFAKEFARNATESGGRSMIIMGGGICHWFHSDVMYRSVLALLMLTGSMGRNGGGWAHYVGQEKVRPLTGWQTMAMATDWSRP
PRQVPGASYWYAHTDQWRYDGYGADKLASPVGRGRFAGKHTMDLLTSATAMGWSPFYPQFDRSSLDVADEARAAGRDVGDYVAEQLAQHKLKLSITDPDN
PVNWPRVLTVWRANLIGSSGKGGEYFLRHLLGTDSNVQSDPPTDGVHPRDVVWDSDIPEGKLDLIMSIDFRMTSTTLVSDVVLPAATWYEKSDLSSTDMH
PYVHSFSPAIDPPWETRSDFDAFAAIARAFSALAKRHLGTRTDVVLTALQHDTPDEMAYPDGTERDWLATGEVPVPGRTMSKLTVVERDYTAIYDKWLTL
GPLIDQFGMTTKGYTVHPFREVSELAANFGVMNSGVAVGRPAITTAKRMADVILALSGTCNGRLAVEGFLELEKRTGQRLAHLAEGSEERRITYADTQAR
PVPVITSPEWSGSESGGRRYAPFTINIEHLKPFHTLTGRMHFYLAHDWVEELGEQLPVYRPPLDMARLFNQPELGPTDDGLGLTVRYLTPHSKWSFHSTY
QDNLYMLSLSRGGPTMWMSPGDAAKINVRDNDWVEAVNANGIYVCRAIVSHRMPEGVVFVYHVQERTVDTPRTETNGKRGGNHNALTRVRIKPSHLAGGY
GQHAFAFNYLGPTGNQRDEVTVVRRRSQEVRY

Additional Information