Rv1146 (mmpL13b)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: transmembrane transport protein MmpL13B
- PATRIC: Transmembrane transport protein MmpL13b
- TUBERCULIST: Probable conserved transmembrane transport protein MmpL13b
- NCBI: Probable conserved transmembrane transport protein MmpL13b
- updated information (H37Rv4):
  - gene name: mmpL13b
  - function:
  - reference:
Type: Not Target
Start: 1273355
End: 1274767
Operon:

Trans-membrane region:
Role: III.A.6 - Efflux proteins
GO terms:
- GO:0052556 - positive regulation by symbiont of host immune response (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on mmpL13b:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.995 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VATVAFVATASIVITPAAIVLLGPRLDALDVRRLVRRLLGRPDPVHKPVKQLFWYRSSKFVMRRWLPVGTAVVALLVLLGLPFLSVKWGFPDDRVLPRSA
SARQVGDILRDDFGHDPATQIPIVVPDARGLGPVELDSYAAELSRVPDVSAVAAPTGTFVDGSWVGTPRGATGLAEGSAFLTVSSTAPLFSRASDIQLKR
LHQVAGPAGRSVVMAGVAQVNRDSVDAVTDRLPMVLGLIAAITYVLLFLLTGSVVLPAKALVCNVLSLTAAFGALVWIFQEGHFGALGTTPSGTLVANMP
VLLFCIAFGLSMDYEVFLVSRIREYWLESGAARPARRSVAEVHAANDESVALGVARTGRVITAAALVMSMSFAALIAAHVSFMRMFGLGLTLAVAADATL
VRMVVVPAFMHVTGRWNWWAPRPLAWLHERFGVSEAAEPVSRRRSHAGGLGKIAGRSDGQTIPASLTRNG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 23 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 23 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 23 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 23 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 23 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 2.34
Growth-Advantage	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1049 (-) (Direct binding)
- Rv1816 (-) (Direct binding)
- Rv1423 (whiA) (Upstream of operon)
- Rv2250c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0735 (sigL)
- Rv3416 (whiB3)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0576 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	XDR-TB genome sequencing: a glimpse of the microbiology of the future. authors,NJ. Loman,MJ. Pallen Future Microbiol 2008	aparna.vchalam	IDA	18366328	In vitro transcription assay
Interaction	Regulatory Rv0735	aparna.vchalam	IDA		In vitro transcription assay authors,NJ. Loman,MJ. Pallen XDR-TB genome sequencing: a glimpse of the microbiology of the future. Future Microbiol 2008
Citation	[Studies on the action of an anticholinergic agent in combination with a tranquilizer on gastric juice secretion in man]. authors,RR. Scherberger,H. Kaess,S. Brckner Arzneimittelforschung 1975	aparna.vchalam	IDA	26	In vitro transcription assay
Interaction	Regulatory Rv0735	aparna.vchalam	IDA		In vitro transcription assay authors,RR. Scherberger,H. Kaess,S. Brckner [Studies on the action of an anticholinergic agent in combination with a tranquilizer on gastric juice secretion in man]. Arzneimittelforschung 1975
Citation	Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. E. Dainese, S. Rodrigue et al. Infect. Immun. 2006	aparna.vchalam	IDA	16552079	In vitro transcription assay
Interaction	Regulatory Rv0735	aparna.vchalam	IDA		In vitro transcription assay E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Citation	Efflux pump-mediated intrinsic drug resistance in Mycobacterium smegmatis. XZ. Li, L. Zhang et al. Antimicrob. Agents Chemother. 2004	aparna.vchalam	IDA	15215089	In vitro transcription assay
Interaction	Regulatory Rv0735	aparna.vchalam	IDA		In vitro transcription assay XZ. Li, L. Zhang et al. Efflux pump-mediated intrinsic drug resistance in Mycobacterium smegmatis. Antimicrob. Agents Chemother. 2004

TB Genome Annotation Portal