Rv1132 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: CONSERVED MEMBRANE PROTEIN
- TUBERCULIST: Conserved membrane protein
- NCBI: hypothetical protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1257325
End: 1259055
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1132:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.138 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MGFLQPRLPDIDLAEWSQGSRSQKIRPMAQHWAEVGFGTPVLLHLFYVAKILLYVLVGWLIVLTTKGIDGFTDAAAWYAEPIVFEKVVLYTMLFEVIGLG
CGFGPLNNRFFPPMGSILYWMRFGTIRLPPWPDRVPWTRGTKRKPVDVALYALLVMMLLSALFTDGAGPIPELGTTVGLLPAWQIVLILLLLGVLGLRDK
VIFLAARGEVYATLTVTFLFGRLNGIDMIVAAKLVFLVIWIGAATSKLNRHFPFVISTMMSNNPLFRPRFIKRMFFKKFPGDLRPGLLSRIVAHVSTVIE
MCVPVVLFVAHGGWPTVVAATIMVCFHLGILTAIPMGVPLEWNVFMIFGVLSLFVGHACLGLADVKNPVPLAILIAVVAGIVIAGNVFPRKISFLAAMRY
YAGNWDTTLWCIKPSAEDKINRGIVAIASMPAAQLERFYGKDRAQIPMYLGYAFRAMNSHGRALFTLAHRAMAGHDEDDYVITDGERVCSTAVGWNFGDG
HLHNEQLIAAMQQRCGFQPGEVRVVLLDAQPIHRQTQEYRLVDAATGEFERGYVRVADMVNRQPWDDDVPVHVLPG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.185550; 6 non-insertions in a row out of 26 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 26 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 26 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 27 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 27 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.52
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-) (Upstream of operon)
- Rv0081 (-) (Upstream of operon)
- Rv0465c (-) (Upstream of operon)
- Rv0678 (-) (Upstream of operon)
- Rv1985c (-) (Upstream of operon)
- Rv3133c (devR) (Upstream of operon)
- Rv3249c (-) (Upstream of operon)
- Rv3597c (lsr2) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0081 (-)
- Rv0818 (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv3574	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Citation	Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. authors,MA. Fisher,BB. Plikaytis,TM. Shinnick J. Bacteriol. 2002	ashwinigbhat	IDA	12081975	Coexpression (Real Time semiquantitative RT-PCR)
Interaction	Transcription Rv1130	ashwinigbhat	IDA		Coexpression (Real Time semiquantitative RT-PCR) authors,MA. Fisher,BB. Plikaytis,TM. Shinnick Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. J. Bacteriol. 2002
Interaction	Transcription Rv1131	ashwinigbhat	IDA		Coexpression (Real Time semiquantitative RT-PCR) authors,MA. Fisher,BB. Plikaytis,TM. Shinnick Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. J. Bacteriol. 2002
Interaction	RegulatedBy Rv3574	yamir.moreno	ISO		M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007

TB Genome Annotation Portal