TB Genome Annotation Portal

Rv1106c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 3 beta-hydroxysteroid dehydrogenase/Delta 5-4-isomerase
  • REFSEQ: cholesterol dehydrogenase
  • PATRIC: PROBABLE CHOLESTEROL DEHYDROGENASE
  • TUBERCULIST: 3-beta-hydroxysteroid dehydrogenase
  • NCBI: 3-beta-hydroxysteroid dehydrogenase
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1232844
• End: 1233956
• Operon:


• Trans-membrane region:
  
• Role: I.B.7 - Miscellaneous oxidoreductases and oxygenases
• GO terms:
  • GO:0102294 - cholesterol dehydrogenase activity (Uniprot)
  • GO:0070403 - NAD+ binding (Uniprot)
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0030283 - testosterone dehydrogenase [NAD(P)] activity (Uniprot)
  • GO:0016853 - isomerase activity (Uniprot)
  • GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0016042 - lipid catabolic process (Uniprot)
  • GO:0008202 - steroid metabolic process (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006694 - steroid biosynthetic process (Uniprot)
  • GO:0006629 - lipid metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0004769 - steroid delta-isomerase activity (Uniprot)
  • GO:0003854 - 3-beta-hydroxy-delta5-steroid dehydrogenase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • H[c] + NAD[c] + CHOLESTEROL[c] -> NADH[c] + CHOLESTENONE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6WJA	38%	Pseudomonas protegens	UDP-GlcNAc C4-epimerase mutant S121A/Y146F from Pseudomonas protegens in complex with UDP-GalNAc
  6WJ9	38%	Pseudomonas protegens	UDP-GlcNAc C4-epimerase mutant S121A/Y146F from Pseudomonas protegens in complex with UDP-GlcNAc
  6JKH	36%	Homo sapiens	cholesterol-decarboxylating enzyme 2
  6JKG	36%	Homo sapiens	cholesterol-decarboxylating enzyme 1

• Links to additional information on Rv1106c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.312 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MLRRMGDASLTTELGRVLVTGGAGFVGANLVTTLLDRGHWVRSFDRAPSLLPAHPQLEVLQGDITDADVCAAAVDGIDTIFHTAAIIELMGGASVTDEYR
QRSFAVNVGGTENLLHAGQRAGVQRFVYTSSNSVVMGGQNIAGGDETLPYTDRFNDLYTETKVVAERFVLAQNGVDGMLTCAIRPSGIWGNGDQTMFRKL
FESVLKGHVKVLVGRKSARLDNSYVHNLIHGFILAAAHLVPDGTAPGQAYFINDAEPINMFEFARPVLEACGQRWPKMRISGPAVRWVMTGWQRLHFRFG
FPAPLLEPLAVERLYLDNYFSIAKARRDLGYEPLFTTQQALTECLPYYVSLFEQMKNEARAEKTAATVKP

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.01 (0.39)	1.25 (0.48)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link