Rv1044 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: FIG00820089: hypothetical protein
- TUBERCULIST: Conserved hypothetical protein
- NCBI: hypothetical protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Essential
Start: 1167053
End: 1167676
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- No terms assigned.
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1044:
- KEGG - nucleotide and amino acid sequences of gene
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -0.443 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- Photo of spot titer

Amino Acid Sequence

LCAKPYLIDTIAHMAIWDRLVEVAAEQHGYVTTRDARDIGVDPVQLRLLAGRGRLERVGRGVYRVPVLPRGEHDDLAAAVSWTLGRGVISHESALALHAL
ADVNPSRIHLTVPRNNHPRAAGGELYRVHRRDLQAAHVTSVDGIPVTTVARTIKDCVKTGTDPYQLRAAIERAEAEGTLRRGSAAELRAALDETTAGLRA
RPKRASA

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.992500; 11 non-insertions in a row out of 13 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999750; 11 non-insertions in a row out of 13 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999900; 12 non-insertions in a row out of 13 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999400; 11 non-insertions in a row out of 13 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999100; 11 non-insertions in a row out of 13 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-) (Direct binding)
- Rv0047c (-) (Direct binding)
- Rv1353c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Transcription Rv1045	priti.priety	RCA		Operon (Functional linkage) authors,B. Kang,D. Vellody,H. Homburger,JW. Yunginger Cockroach cause of allergic asthma. Its specificity and immunologic profile. J. Allergy Clin. Immunol. 1979
Citation	Horizontally acquired genomic islands in the tubercle bacilli. authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Trends Microbiol. 2008	priti.priety	RCA	18515114	Operon (Functional linkage)
Interaction	Transcription Rv1045	priti.priety	RCA		Operon (Functional linkage) authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Citation	Cockroach cause of allergic asthma. Its specificity and immunologic profile. authors,B. Kang,D. Vellody,H. Homburger,JW. Yunginger J. Allergy Clin. Immunol. 1979	ashwinigbhat	RCA	83332	Operon (Functional linkage)
Interaction	Transcription Rv1045	ashwinigbhat	RCA		Operon (Functional linkage) authors,B. Kang,D. Vellody,H. Homburger,JW. Yunginger Cockroach cause of allergic asthma. Its specificity and immunologic profile. J. Allergy Clin. Immunol. 1979
Citation	Horizontally acquired genomic islands in the tubercle bacilli. authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Trends Microbiol. 2008	ashwinigbhat	RCA	18515114	Operon (Functional linkage)
Interaction	Transcription Rv1045	ashwinigbhat	RCA		Operon (Functional linkage) authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Citation	Cockroach cause of allergic asthma. Its specificity and immunologic profile. authors,B. Kang,D. Vellody,H. Homburger,JW. Yunginger J. Allergy Clin. Immunol. 1979	priti.priety	RCA	83332	Operon (Functional linkage)

TB Genome Annotation Portal