TB Genome Annotation Portal

Rv1033c (trcR)

Amino Acid Sequence

MTTMSGYTRSQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMALHYEGWDVEVAHDGQEAIAKFDKVGPDVLVLDIMLPDVDGLEILRRVRES
DVYTPTLFLTARDSVMDRVTGLTSGADDYMTKPFSLEELVARLRGLLRRSSHLERPADEALRVGDLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPR
RALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSDREPMIHTVRGIGYMLRPPE
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 15 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 15 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 15 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 15 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 15 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 3.4
Growth-Advantage 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1033c (trcR)

    PropertyValueCreatorEvidencePMIDComment
    InteractionInhibits Rv1057ashwinigbhatIDADNase I and hydroxyl radical footprinting analyses
    SE. Haydel & JE. Clark-Curtiss The Mycobacterium tuberculosis TrcR response regulator represses transcription of the intracellularly expressed Rv1057 gene, encoding a seven-bladed beta-propeller. J. Bacteriol. 2006
    InteractionRegulatory Rv1032cdarhnguIEPCo-expression (Functional linkage)
    SE. Haydel, NE. Dunlap et al. In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. Microb. Pathog. 1999
    InteractionRegulatory Rv1032cdarhnguIEPCo-expression (Functional linkage)
    L. Wernisch, SL. Kendall et al. Analysis of whole-genome microarray replicates using mixed models. Bioinformatics 2003
    CitationThe Mycobacterium tuberculosis TrcR response regulator represses transcription of the intracellularly expressed Rv1057 gene, encoding a seven-bladed beta-propeller. SE. Haydel & JE. Clark-Curtiss J. Bacteriol. 2006ahal4789IEP16352831Co-expression (Functional linkage)
    InteractionRegulatory Rv1057ahal4789IEPCo-expression (Functional linkage)
    SE. Haydel & JE. Clark-Curtiss The Mycobacterium tuberculosis TrcR response regulator represses transcription of the intracellularly expressed Rv1057 gene, encoding a seven-bladed beta-propeller. J. Bacteriol. 2006
    CitationThe Mycobacterium tuberculosis TrcR response regulator represses transcription of the intracellularly expressed Rv1057 gene, encoding a seven-bladed beta-propeller. SE. Haydel & JE. Clark-Curtiss J. Bacteriol. 2006sourish10IEP16352831Co-expression (Functional linkage)
    InteractionRegulatory Rv1057sourish10IEPCo-expression (Functional linkage)
    SE. Haydel & JE. Clark-Curtiss The Mycobacterium tuberculosis TrcR response regulator represses transcription of the intracellularly expressed Rv1057 gene, encoding a seven-bladed beta-propeller. J. Bacteriol. 2006
    CitationIn vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. SE. Haydel, NE. Dunlap et al. Microb. Pathog. 1999akankshajain.21IEP10089160Co-expression (Functional linkage)
    InteractionRegulatory Rv1032cakankshajain.21IEPCo-expression (Functional linkage)
    SE. Haydel, NE. Dunlap et al. In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. Microb. Pathog. 1999
    CitationAnalysis of whole-genome microarray replicates using mixed models. L. Wernisch, SL. Kendall et al. Bioinformatics 2003akankshajain.21IEP12499293Co-expression (Functional linkage)
    InteractionRegulatory Rv1032cakankshajain.21IEPCo-expression (Functional linkage)
    L. Wernisch, SL. Kendall et al. Analysis of whole-genome microarray replicates using mixed models. Bioinformatics 2003
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1033cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv1033cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1057yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments