TB Genome Annotation Portal

Rv1032c (trcS)

Amino Acid Sequence

MIPDRNTRSRKAPCWRPRSLRQQLLLGVLAVVTVVLVAVGVVSVLSLSGYVTAMNDAELVESLHALNHSYTRYRDSAQTSTPTGNLPMSQAVLEFTGQTP
GNLIAVLHDGVVIGSAVFSEDGARPAPPDVIRAIEAQVWDGGPPRVESLGSLGAYQVDSSAAGADRLFVGVSLSLANQIIARKKVTTVALVGAALVVTAA
LTVWVVGYALRPLRRVAATAAEVATMPLTDDDHQISVRVRPGDTDPDNEVGIVGHTLNRLLDNVDGALAHRVDSDLRMRQFITDASHELRTPLAAIQGYA
ELTRQDSSDLPPTTEYALARIESEARRMTLLVDELLLLSRLSEGEDLETEDLDLTDLVINAVNDAAVAAPTHRWVKNLPDEPVWVNGDHARLHQLVSNLL
TNAWVHTQPGVTVTIGITCHRTGPNAPCVELSVTDDGPDIDPEILPHLFDRFVRASKSRSNGSGHGLGLAIVSSIVKAHRGSVTAESGNGQTVFRVRLPM
IEQQIATTA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
6 non-insertions in a row out of 25 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 25 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 25 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 25 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 25 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.65
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1032c (trcS)

    PropertyValueCreatorEvidencePMIDComment
    InteractionInhibits Rv1057ashwinigbhatIDADNase I and hydroxyl radical footprinting analyses
    SE. Haydel & JE. Clark-Curtiss The Mycobacterium tuberculosis TrcR response regulator represses transcription of the intracellularly expressed Rv1057 gene, encoding a seven-bladed beta-propeller. J. Bacteriol. 2006
    InteractionRegulatory Rv1033cakankshajain.21IEPCo-expression (Functional linkage)
    L. Wernisch, SL. Kendall et al. Analysis of whole-genome microarray replicates using mixed models. Bioinformatics 2003
    CitationAnalysis of whole-genome microarray replicates using mixed models. L. Wernisch, SL. Kendall et al. Bioinformatics 2003darhnguIEP12499293Co-expression (Functional linkage)
    InteractionRegulatory Rv1033cdarhnguIEPCo-expression (Functional linkage)
    L. Wernisch, SL. Kendall et al. Analysis of whole-genome microarray replicates using mixed models. Bioinformatics 2003
    InteractionRegulatory Rv1033cakankshajain.21IEPCo-expression (Functional linkage)
    SE. Haydel, NE. Dunlap et al. In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. Microb. Pathog. 1999
    CitationIn vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. SE. Haydel, NE. Dunlap et al. Microb. Pathog. 1999darhnguIEP10089160Co-expression (Functional linkage)
    InteractionRegulatory Rv1033cdarhnguIEPCo-expression (Functional linkage)
    SE. Haydel, NE. Dunlap et al. In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins. Microb. Pathog. 1999

    Comments