Rv0987 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: ABC transporter permease
- REFSEQ: adhesion component transport transmembrane protein ABC transporter
- PATRIC: AttF component of AttEFGH ABC transport system / AttG component of AttEFGH ABC transport system
- TUBERCULIST: Probable adhesion component transport transmembrane protein ABC transporter
- NCBI: Probable adhesion component transport transmembrane protein ABC transporter
- updated information (H37Rv4):
  - gene name: -
  - function: ABC-transporter; implicated in preventing acidification and phagosome maturation
  - reference: Pethe (2004) PMID: 15340136
Type: Not Target
Start: 1102542
End: 1105109
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv0987:
- Mycobrowser
- PATRIC
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.12 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology

Amino Acid Sequence

MNDQAPVAYAPLWRTAWRRLRQRPFQYILLVLGIALGVAMIVAIDVSSNSAQRAFDLSAAAITGKSTHRLVSGPAGVDQQLYVDLRRHGYDFSAPVIEGY
VLARGLGNRAMQFMGTDPFAESAFRSPLWSNQNIAELGGFLTRPNGVVLSRQVAQKYGLAVGDRIALQVKGAPTTVTLVGLLTPADEVSNQKLSDLIIAD
ISTAQELFHMPGRLSHIDLIIKDEATATRIQQRLPAGVRMETSDTQRDTVKQMTDAFTVNLTALSLIALLVGIFLIYNTVTFNVVQRRPFFAILRCLGVT
REQLFWLIMTESLVAGLIGTGLGLLIGIWLGEGLIGLVTQTINDFYFVINVRNVSVSAESLLKGLIIGIFAAMLATLPPAIEAMRTVPASTLRRSSLESK
ITKLMPWLWVAWFGLGSFGVLMLWLPGNNLVVAFVGLFSVLIALALIAPPLTRFVMLRLAPGLGRLLGPIGRMAPRNIVRSLSRTSIAIAALMMAVSLMV
GVSISVGSFRQTLANWLEVTLKSDVYVSPPTLTSGRPSGNLPVDAVRNISKWPGVRDAVMARYSSVFAPDWGREVELMAVSGDISDGKRPYRWIDGNKDT
LWPRFLAGKGVMLSEPMVSRQHLQMPPRPITLMTDSGPQTFPVLAVFSDYTSDQGVILMDRASYRAHWQDDDVTTMFLFLASGANSGALIDQLQAAFAGR
EDIVIQSTHSVREASMFIFDRSFTITIALQLVATVVAFIGVLSALMSLELDRAHELGVFRAIGMTTRQLWKLMFIETGLMGGMAGLMALPTGCILAWILV
RIINVRSFGWTLQMHFESAHFLRALLVAVVAALAAGMYPAWRLGRMTIRTAIREE

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.998900; 20 non-insertions in a row out of 94 sites
Uncertain	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.679450; 14 non-insertions in a row out of 94 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 20 non-insertions in a row out of 94 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.998750; 15 non-insertions in a row out of 94 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999900; 17 non-insertions in a row out of 94 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1033c (trcR) (Direct binding)
- Rv0047c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Interaction	PhysicalInteraction Rv0986	raj252000	RCA		Operon (Functional linkage) V. Rosas-Magallanes, P. Deschavanne et al. Horizontal transfer of a virulence operon to the ancestor of Mycobacterium tuberculosis. Mol. Biol. Evol. 2006
Citation	Horizontal transfer of a virulence operon to the ancestor of Mycobacterium tuberculosis. V. Rosas-Magallanes, P. Deschavanne et al. Mol. Biol. Evol. 2006	raj252000	RCA	16520338	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv0986	raj252000	RCA		Operon (Functional linkage) V. Rosas-Magallanes, P. Deschavanne et al. Horizontal transfer of a virulence operon to the ancestor of Mycobacterium tuberculosis. Mol. Biol. Evol. 2006
Interaction	Operon Rv0988	raj252000	RCA		Operon (Functional linkage) V. Rosas-Magallanes, P. Deschavanne et al. Horizontal transfer of a virulence operon to the ancestor of Mycobacterium tuberculosis. Mol. Biol. Evol. 2006
Citation	Mycobacterium tuberculosis invasion and traversal across an in vitro human blood-brain barrier as a pathogenic mechanism for central nervous system tuberculosis. SK. Jain, M. Paul-Satyaseela et al. J. Infect. Dis. 2006	jlew		16586367	Mutant is deficient in ability to invade the BBB.. Microarrays found 33 M. tuberculosis genes highly up-regulated during the early stages of invasion of the BBB by M. tuberculosis. M. tuberculosis isogenic transposon mutants for the up-regulated genes Rv0980c, Rv0987, Rv0989c, and Rv1801 were found to be deficient in their ability to invade the BBB model.

TB Genome Annotation Portal