TB Genome Annotation Portal

Rv0821c (phoY2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: phosphate transporter regulatory protein PhoU
  • REFSEQ: phosphate transport regulator
  • PATRIC: Phosphate transport system regulatory protein PhoU
  • TUBERCULIST: Probable phosphate-transport system transcriptional regulatory protein PhoY2
  • NCBI: Probable phosphate-transport system transcriptional regulatory protein PhoY2
  • updated information (H37Rv4):
    • gene name: phoY2
    • function:
    • reference: (Namugenyi, 2017)
• Type: Not Target
• Start: 913558
• End: 914199
• Operon:


• Trans-membrane region:
  
• Role: III.A.4 - Anions
• GO terms:
  • GO:0045936 - negative regulation of phosphate metabolic process (Uniprot)
  • GO:0030643 - cellular phosphate ion homeostasis (Uniprot)
  • GO:0022611 - dormancy process (Uniprot)
  • GO:0006817 - phosphate ion transport (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on phoY2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.289 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEV
ARRVIFQATGAFP

Additional Information