TB Genome Annotation Portal

Rv0746 (PE_PGRS9)

Amino Acid Sequence

MSFVLAMPEVLGSAATDLAALGSVLGAADAAAAATTTGIVAAAQDEVSAAIAALFSAHGRAYQVASAQAAAVHAQFVEALSAGAGAYASAEAAGAAVLAN
PAQSVQQDLLAAVNAQSVALTGRPLIGNGANGAPGTGANGAPGGWLLGNGGAGGSAAAGSGLPGGAGGAAGLFGTGGAGGAGGSSTVGDGEAGGAGGSGG
WLLGTGGVGGVGGLGAGAGGAGGVGGAGGLLGAGGHGGAGGLGAVTGGVGGTGGAGGLLAGLLAGPGGAGGTGGRGFLNNGGVGGAGGNAGLLFGAGGTG
GSGGAGLGGDGGAGGAGGNTGVLFGNAGSGGTGGFGDTDGGAGGAGGDAGWLGSGGVGGAGGFGETGDGGVGGAGGKAGLLIGNGGAGGAGGQGAVTGGT
GGAGGDGVLIGNGGNAGIGGTGPTAGDTGAGGISGLLLGADGFNTPASASPLHTLKQQALAAINAPTQTLTGRPLIGNGTPGAVGSGATGAPGGWLLGDG
GAGGSGAAGSGAPGGAGGAAGLWGTGGAGGAGGSSAGGGGAGGAGGAGGWLLGDGGAGGIGGASTVLGGTGGGGGVGGLWGAGGAGGAGGTGLVGGDGGA
GGAGGTGGLLAGLIGAGGGHGGTGGLSTNGDGGVGGAGGNAGMLAGPGGAGGAGGDGENLDTGGDGGAGGSAGLLFGSGGAGGAGGFGFLGGDGGAGGNA
GLLLSSGGAGGFGGFGTAGGVGGAGGNAGWLGFGGAGGVGGSAGLIGTGGNGGNGGTGANAGSPGTGGAGGLLLGQNGLNGLP
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.416950;
6 non-insertions in a row out of 15 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.727450;
6 non-insertions in a row out of 15 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.775800;
6 non-insertions in a row out of 15 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000050;
3 non-insertions in a row out of 16 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 16 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0746 (PE_PGRS9)

    PropertyValueCreatorEvidencePMIDComment
    CitationPE_PGRS proteins are differentially expressed by Mycobacterium tuberculosis in host tissues. G. Delogu, M. Sanguinetti et al. Microbes Infect. 2006sourish10IEP16798044Co-expression (Functional linkage)
    InteractionTranscription Rv0745sourish10IEPCo-expression (Functional linkage)
    G. Delogu, M. Sanguinetti et al. PE_PGRS proteins are differentially expressed by Mycobacterium tuberculosis in host tissues. Microbes Infect. 2006
    CitationIn vitro analysis of rates and spectra of mutations in a polymorphic region of the Rv0746 PE_PGRS gene of Mycobacterium tuberculosis. EE. Machowski, S. Barichievy et al. J. Bacteriol. 2007sourish10IEP17172340Co-expression (Functional linkage)
    InteractionTranscription Rv0745sourish10IEPCo-expression (Functional linkage)
    EE. Machowski, S. Barichievy et al. In vitro analysis of rates and spectra of mutations in a polymorphic region of the Rv0746 PE_PGRS gene of Mycobacterium tuberculosis. J. Bacteriol. 2007
    CitationPE_PGRS proteins are differentially expressed by Mycobacterium tuberculosis in host tissues. G. Delogu, M. Sanguinetti et al. Microbes Infect. 2006jlew16798044in axenic cultures, significant up-regulation occurring at late log and early stationary phases. Significant upreglation in mice in the spleen. quantitative real-time RT-PCR (QRT-PCR) was implemented to assess expression of three PE_PGRS genes under different experimental conditions.

    Comments