TB Genome Annotation Portal

Rv0673 (echA4)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: enoyl-CoA hydratase
  • REFSEQ: enoyl-CoA hydratase
  • PATRIC: Enoyl-CoA hydratase
  • TUBERCULIST: Possible enoyl-CoA hydratase EchA4 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  • NCBI: Possible enoyl-CoA hydratase EchA4 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  • updated information (H37Rv4):
    • gene name: echA4
    • function:
    • reference:
• Type: Not Target
• Start: 773123
• End: 774061
• Operon:


• Trans-membrane region:
  
• Role: I.A.3 - Fatty acids
• GO terms:
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3NJD	89%	Mycobacterium smegmatis	Crystal structure of enoyl-coa hydratase from mycobacterium smegmatis
  3NJB	89%	Mycobacterium smegmatis	Crystal structure of enoyl-coa hydratase from Mycobacterium smegmatis, iodide soak

• Links to additional information on echA4:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.162 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLELSALVERADLDPGVHVILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDG
KTQAVNHLPNQPWDPMIDYQMMSRFVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVPAAGLWAHRLGDQRAKRLLFT
GDCITGAQAAEWGLAVEAPEPADLDERTERLVARIAALPVNQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHAFVADAVEHGFRDAVRRRDE
PFGDYGRQASRV

Additional Information