TB Genome Annotation Portal

Rv0657c (vapB6)

Amino Acid Sequence

VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Too-Short Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites
Too-Short Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites
Too-Short Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites
Too-Short minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: -1.000000;
1 non-insertions in a row out of 2 sites
Too-Short minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: -1.000000;
1 non-insertions in a row out of 2 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 3.38
Growth-Advantage 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0657c (vapB6)

    PropertyValueCreatorEvidencePMIDComment
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009ashwinigbhatIGC20011113Gene Neighborhood (Functional linkage)
    InteractionInhibits Rv0656cashwinigbhatIGCGene Neighborhood (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    InteractionInhibits Rv0656cpriti.prietyIGCGene Neighborhood (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    InteractionInhibits Rv0656cashwinigbhatIGCGene Neighborhood (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009priti.prietyIGC20011113Gene Neighborhood (Functional linkage)
    InteractionInhibits Rv0656cpriti.prietyIGCGene Neighborhood (Functional linkage)
    authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
    SymbolVapB6jlewWe report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    Otherstop:753617rslaydenMTCY39.08c
    Otherstrand:+rslaydenMTCY39.08c
    SymbolVap BC-6rslaydenYW08_MYCTU
    Otherstart:753462rslaydenYW08_MYCTU
    Otherstop:753617rslaydenYW08_MYCTU
    Otherstrand:+rslaydenYW08_MYCTU
    SymbolVap BC-6rslaydenQ10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
    Otherstart:753462rslaydenQ10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
    Otherstop:753617rslaydenQ10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
    Otherstrand:+rslaydenQ10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
    SymbolVap BC-6rslaydenSC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
    Otherstart:753462rslaydenSC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
    Otherstop:753617rslaydenSC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
    Otherstrand:+rslaydenSC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
    Otherstart:753462rslaydenMTCY39.08c
    SymbolVap BC-6rslaydenConserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
    Otherstart:753462rslaydenConserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
    Otherstop:753617rslaydenConserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
    Otherstrand:+rslaydenConserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
    SymbolVap BC-6rslaydenMT2064.1
    Otherstart:753462rslaydenMT2064.1
    Otherstop:753617rslaydenMT2064.1
    Otherstrand:+rslaydenMT2064.1
    SymbolVap BC-6rslaydenMTCY39.08c

    Comments