TB Genome Annotation Portal

Rv0651 (rplJ)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 50S ribosomal protein L10
  • REFSEQ: 50S ribosomal protein L10
  • PATRIC: LSU ribosomal protein L10p (P0)
  • TUBERCULIST: 50S ribosomal protein L10 RplJ
  • NCBI: 50S ribosomal protein L10 RplJ
  • updated information (H37Rv4):
    • gene name: rplJ
    • function:
    • reference:
• Type: Not Target
• Start: 748276
• End: 748812
• Operon:


• Trans-membrane region:
  
• Role: II.A.1 - Ribosomal protein synthesis and modification
• GO terms:
  • GO:0042254 - ribosome biogenesis (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0030529 - not-found (Uniprot)
  • GO:0022625 - cytosolic large ribosomal subunit (Uniprot)
  • GO:0019843 - rRNA binding (Uniprot)
  • GO:0006412 - translation (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005840 - ribosome (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0003735 - structural constituent of ribosome (Uniprot)
  • GO:0003723 - RNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6DZP	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Cryo-EM Structure of Mycobacterium smegmatis C(minus) 50S ribosomal subunit
  5ZET	86%	Mycobacterium smegmatis str. MC2 155	M. smegmatis P/P state 50S ribosomal subunit
  5ZEP	86%	Mycobacterium smegmatis str. MC2 155	M. smegmatis hibernating state 70S ribosome structure
  5ZEB	86%	Mycobacterium smegmatis str. MC2 155	M. Smegmatis P/P state 70S ribosome structure
  5O61	86%	Mycobacterium smegmatis str. MC2 155	The complete structure of the Mycobacterium smegmatis 70S ribosome
  5O60	86%	Mycobacterium smegmatis str. MC2 155	Structure of the 50S large ribosomal subunit from Mycobacterium smegmatis
  6DZI	83%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Cryo-EM Structure of Mycobacterium smegmatis 70S C(minus) ribosome 70S-MPY complex
  5NJT	42%	Bacillus subtilis subsp. subtilis str. 168	Structure of the Bacillus subtilis hibernating 100S ribosome reveals the basis for 70S dimerization.
  6TPQ	40%	Bacillus subtilis subsp. subtilis str. 168	RNase M5 bound to 50S ribosome with precursor 5S rRNA
  6TNN	40%	Bacillus subtilis subsp. subtilis str. 168	Mini-RNase III (Mini-III) bound to 50S ribosome with precursor 23S rRNA

• Links to additional information on rplJ:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -14.022 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • Photo of spot titer

Amino Acid Sequence

MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTGSATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEH
KALVIKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAAALQEKKACPGPDSAE

Additional Information