TB Genome Annotation Portal

Rv0500 (proC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: pyrroline-5-carboxylate reductase
  • REFSEQ: pyrroline-5-carboxylate reductase
  • PATRIC: Pyrroline-5-carboxylate reductase (EC 1.5.1.2)
  • TUBERCULIST: Probable pyrroline-5-carboxylate reductase ProC (P5CR) (P5C reductase)
  • NCBI: Probable pyrroline-5-carboxylate reductase ProC (P5CR) (P5C reductase)
  • updated information (H37Rv4):
    • gene name: proC
    • function:
    • reference:
• Type: Not Target
• Start: 590083
• End: 590970
• Operon:


• Trans-membrane region:
  
• Role: I.D.1 - Glutamate family
• GO terms:
  • GO:0055129 - L-proline biosynthetic process (Uniprot)
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0030145 - manganese ion binding (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0006561 - proline biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0004735 - pyrroline-5-carboxylate reductase activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • NADH[c] + NADPH[c] + 2 P5C[c] <=> NAD[c] + NADP[c] + 2 PRO[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on proC:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -6.705 (from Jeremy Rock's lab)

Amino Acid Sequence

MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAADAVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVF
VTVVAGITIAYFESKLPAGTPVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSGSGPAYFFLLVEALVDAGVGV
GLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGLRVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE

Additional Information