TB Genome Annotation Portal

Rv0384c (clpB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: chaperone ClpB
  • REFSEQ: endopeptidase ATP binding protein
  • PATRIC: ClpB protein
  • TUBERCULIST: Probable endopeptidase ATP binding protein (chain B) ClpB (ClpB protein) (heat shock protein F84.1)
  • NCBI: Probable endopeptidase ATP binding protein (chain B) ClpB (ClpB protein) (heat shock protein F84.1)
  • updated information (H37Rv4):
    • gene name: clpB
    • function:
    • reference:
• Type: Not Target
• Start: 459456
• End: 462002
• Operon:


• Trans-membrane region:
  
• Role: III.B - Chaperones/Heat shock
• GO terms:
  • GO:0042026 - protein refolding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0019538 - protein metabolic process (Uniprot)
  • GO:0009408 - response to heat (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6ED3	99%	Mycobacterium tuberculosis	Mtb ClpB in complex with AMPPNP
  6DJV	99%	Mycobacterium tuberculosis	Mtb ClpB in complex with ATPgammaS and casein, Conformer 2
  6DJU	99%	Mycobacterium tuberculosis	Mtb ClpB in complex with ATPgammaS and casein, Conformer 1
  1JBK	74%	Escherichia coli	Crystal Structure of the First Nucelotide Binding Domain of ClpB
  2P65	69%	Plasmodium falciparum	Crystal Structure of the first nucleotide binding domain of chaperone ClpB1, putative, (Pv089580) from Plasmodium Vivax
  6EMW	69%	Staphylococcus aureus (strain bovine RF122 / ET3-1)	Structure of S.aureus ClpC in complex with MecA
  4HSE	63%	Thermus thermophilus	Crystal structure of ClpB NBD1 in complex with guanidinium chloride and ADP
  4LJ6	61%	Thermus thermophilus	ClpB NBD2 from T. thermophilus in complex with AMPPCP
  4LJ5	61%	Thermus thermophilus	ClpB NBD2 from T. thermophilus in complex with ADP
  4LJ4	61%	Thermus thermophilus	ClpB NBD2 from T. thermophilus, nucleotide-free

• Links to additional information on clpB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -3.553 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGIAAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATE
LDDEYVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQKYSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKN
NPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGEGAMDAGNMI
KPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVGEPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAAS
RLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAELTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAA
ELRYGRIPEVEKKLDAALPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQKAAVTAVSDAVRRSRAGVSDPNRPT
GAFMFLGPTGVGKTELAKALADFLFDDERAMVRIDMSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQVLDEGR
LTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIFEGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDP
VYGARPLRRLVQQAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG

Additional Information