TB Genome Annotation Portal

Rv0384c (clpB)

Amino Acid Sequence

VDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGIAAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATE
LDDEYVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQKYSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKN
NPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGEGAMDAGNMI
KPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVGEPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAAS
RLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAELTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAA
ELRYGRIPEVEKKLDAALPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQKAAVTAVSDAVRRSRAGVSDPNRPT
GAFMFLGPTGVGKTELAKALADFLFDDERAMVRIDMSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQVLDEGR
LTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIFEGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDP
VYGARPLRRLVQQAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.8 (0.32)1.08 (0.42)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0384c/clpB, gene len: 2546 bp, num TA sites: 25
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifegrowth defect7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifegrowth defectBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.05)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=-4.56)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0384c (clpB)

    PropertyValueCreatorEvidencePMIDComment
    InteractionInhibits Rv1222harsharohiratruefriendIDAaffinity purification
    S. Barik, K. Sureka et al. RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis. Mol. Microbiol. 2010
    InteractionInhibits Rv1222harsharohiratruefriendIDAaffinity purification
    R. Manganelli,R. Provvedi,S. Rodrigue,J. Beaucher,L. Gaudreau,I. Smith,R. Proveddi Sigma factors and global gene regulation in Mycobacterium tuberculosis. J. Bacteriol. 2004
    InteractionRegulatory Rv3223cmanish.srcpIEPCo-expression (Functional linkage)
    S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
    CitationThe Mycobacterium tuberculosis sigma factor sigmaB is required for full response to cell envelope stress and hypoxia in vitro, but it is dispensable for in vivo growth. PA. Fontn,MI. Voskuil,M. Gomez,D. Tan,M. Pardini,R. Manganelli,L. Fattorini,GK. Schoolnik,I. Smith J. Bacteriol. 2009manish.srcpIEP19592585Co-expression (Functional linkage)
    InteractionRegulatory Rv3223cmanish.srcpIEPCo-expression (Functional linkage)
    PA. Fontn,MI. Voskuil,M. Gomez,D. Tan,M. Pardini,R. Manganelli,L. Fattorini,GK. Schoolnik,I. Smith The Mycobacterium tuberculosis sigma factor sigmaB is required for full response to cell envelope stress and hypoxia in vitro, but it is dispensable for in vivo growth. J. Bacteriol. 2009
    CitationThe alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. S. Raman, T. Song et al. J. Bacteriol. 2001manish.srcpIEP11567012Co-expression (Functional linkage)
    InteractionRegulatory Rv0182cpriti.prietyIEPCo-expression (Functional linkage)
    JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
    InteractionRegulatedBy Rv0182cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
    InteractionRegulatedBy Rv3223cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0353yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments