TB Genome Annotation Portal

Rv0353 (hspR)

Amino Acid Sequence

MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELA
VLRANQRREVAVVPKSTALVVWKPRR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 6 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 6 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 6 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 6 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 6 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.47
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0353 (hspR)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv2374cchirupoloIMPCo Expression (Functional linkage)
    GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
    InteractionPhysicalInteraction Rv2288hibeeluckIEPCo-occurance (Functional Linkage)
    GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
    CitationMycobacterium tuberculosis pathogenesis and molecular determinants of virulence. authors,I. Smith Clin. Microbiol. Rev. 2003dimpi.srcpIDA12857778Band Shift
    InteractionRegulatory Rv0350dimpi.srcpIDABand Shift
    authors,I. Smith Mycobacterium tuberculosis pathogenesis and molecular determinants of virulence. Clin. Microbiol. Rev. 2003
    InteractionSignaling Rv0350shahanup86IDACo occurance (Functional Linkage)
    TB. Hickey, LM. Thorson et al. Mycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. Infect. Immun. 2009
    InteractionSignaling Rv0350shahanup86IDACo occurance (Functional Linkage)
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    InteractionSignaling Rv0350shahanup86IDACo occurance (Functional Linkage)
    authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Complementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. Arch. Microbiol. 2004
    CitationModulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. T. Das Gupta, B. Bandyopadhyay et al. Microbiology (Reading, Engl.) 2008dimpi.srcpIDA18227252Band Shift
    InteractionRegulatory Rv0350dimpi.srcpIDABand Shift
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    InteractionSignaling Rv0350shahanup86IDAGene Neighborhood (Functional Linkage)
    TB. Hickey, LM. Thorson et al. Mycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. Infect. Immun. 2009
    InteractionSignaling Rv0350shahanup86IDAGene Neighborhood (Functional Linkage)
    T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
    InteractionSignaling Rv0350shahanup86IDAGene Neighborhood (Functional Linkage)
    authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Complementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. Arch. Microbiol. 2004
    InteractionRegulatory Rv0268cdarhnguNASCo-expression (Functional linkage)
    GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
    InteractionInhibition Rv0250chibeeluckRCA
    authors,K. Kurihashi Letter: Fine cotton thread method of lacrimation. Lancet 1976
    InteractionInhibition Rv0250chibeeluckRCA
    PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
    InteractionInhibition Rv0250chibeeluckRCA
    authors,M. Berney,GM. Cook Unique flexibility in energy metabolism allows mycobacteria to combat starvation and hypoxia. PLoS ONE 2010
    InteractionTranscription Rv0250csourish10IMPCo-expression (Functional linkage)
    GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
    InteractionTranscription Rv0250csourish10IEPCo-expression (Functional linkage)
    GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
    InteractionRegulatory Rv0004shahanup86IEPCo-expression (Functional linkage)
    GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
    InteractionRegulatedBy Rv3416yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3133cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2034yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv1221yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0981yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0491yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulates Rv0252yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0350yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0384cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0385yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0251cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

    Comments