TB Genome Annotation Portal

Rv0264c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54)
  • TUBERCULIST: Conserved hypothetical protein
  • NCBI: hypothetical protein
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 315783
• End: 316415
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0052562 - negative regulation by symbiont of host immune response (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3MML	65%	Mycobacterium smegmatis	Allophanate Hydrolase Complex from Mycobacterium smegmatis, Msmeg0435-Msmeg0436
  2ZP2	37%	Bacillus subtilis	C-terminal domain of KipI from Bacillus subtilis
  3ORE	36%	Thermus thermophilus	Crystal structure of TTHA0988 in space group P6522
  3OPF	36%	Thermus thermophilus	Crystal structure of TTHA0988 in space group P212121
  3OEP	36%	Thermus thermophilus	Crystal structure of TTHA0988 in space group P43212
  5DUD	35%	Escherichia coli (strain K12)	Crystal structure of E. coli YbgJK

• Links to additional information on Rv0264c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.401 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAALPGVVDIVAASRTVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDGPDLA
EVARCTGLTTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPSLRVPRRPERRTSMPPGSVALADGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLT
PGMWVQFRAA

Additional Information