Rv0203 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: POSSIBLE EXPORTED PROTEIN
- TUBERCULIST: Possible exported protein
- NCBI: Possible exported protein
- updated information (H37Rv4):
  - gene name: -
  - function: implicated in heme uptake; crystal structure; binds heme
  - reference: Tullius 2011, PMID: 21383189
Type: Not Target
Start: 241514
End: 241924
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- GO:0046872 - metal ion binding (Uniprot)
- GO:0020037 - heme binding (Uniprot)
- GO:0015886 - heme transport (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3may
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

3MAY 100% Mycobacterium tuberculosis Crystal structure of a secreted Mycobacterium tuberculosis heme-binding protein
Links to additional information on Rv0203:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.187 (from Jeremy Rock's lab)

PDB	aa ident	species	PDB title
3MAY	100%	Mycobacterium tuberculosis	Crystal structure of a secreted Mycobacterium tuberculosis heme-binding protein

Amino Acid Sequence

MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASEVARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASD
LHALSQPLTDLSTRCSLPISGLQAIGLMQAVQGARR

(Nucleotide sequence available on KEGG)

Additional Information

Discovery and characterization of a unique mycobacterial heme acquisition system.
Tullius, M.V., Harmston, C.A., Owens, C.P., Chim, N., Morse, R.P., McMath, L.M.,
Iniguez, A., Kimmey, J.M., Sawaya, M.R., Whitelegge, J.P., Horwitz, M.A., Goulding, C.W.
(2011) Proc Natl Acad Sci U S A 108: 5051-5056. PubMed: 21383189

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 3 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 3 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 3 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 4 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 4 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0260c (-)
- Rv0818 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0302 (-) (Direct binding)
- Rv1033c (trcR) (Direct binding)
- Rv1990c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	PMID	Comment
Citation	Discovery and characterization of a unique mycobacterial heme acquisition system. authors,MV. Tullius,CA. Harmston,CP. Owens,N. Chim,RP. Morse,LM. McMath,A. Iniguez,JM. Kimmey,MR. Sawaya,JP. Whitelegge,MA. Horwitz,CW. Goulding Proc. Natl. Acad. Sci. U.S.A. 2011	jlew	21383189	Structure solved (predicted tat substrate). We identified the genomic region, Rv0202cRv0207c, responsible for the passage of heme iron across the mycobacterial membrane.
Citation	Discovery and characterization of a unique mycobacterial heme acquisition system. authors,MV. Tullius,CA. Harmston,CP. Owens,N. Chim,RP. Morse,LM. McMath,A. Iniguez,JM. Kimmey,MR. Sawaya,JP. Whitelegge,MA. Horwitz,CW. Goulding Proc. Natl. Acad. Sci. U.S.A. 2011	jlew	21383189	Involved in heme uptake. We identified the genomic region, Rv0202cRv0207c, responsible for the passage of heme iron across the mycobacterial membrane.
Citation	Characterization of Heme Ligation Properties of Rv0203, a Secreted Heme Binding Protein Involved in Mycobacterium tuberculosis Heme Uptake. authors,CP. Owens,J. Du,JH. Dawson,CW. Goulding Biochemistry 2012	jlew	22283334	In this work, we use spectroscopic methods to further characterize the heme coordination environments of His-tagged and native protein forms of Rv0203.

TB Genome Annotation Portal