TB Genome Annotation Portal

Rv0129c (fbpC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: antigen 85-C
  • REFSEQ: secreted antigen 85-C FBPC (85C) (antigen 85 complex C) (AG58C) (Mycolyl transferase 85C) (fibronectin-binding protein C)
  • PATRIC: Antigen 85-C precursor (85C) (Antigen 85 complex C) (Ag85C) (Mycolyl transferase 85C) (EC 2.3.1.-)
  • TUBERCULIST: Secreted antigen 85-C FbpC (85C) (antigen 85 complex C) (AG58C) (mycolyl transferase 85C) (fibronectin-binding protein C)
  • NCBI: Secreted antigen 85-C FbpC (85C) (antigen 85 complex C) (AG58C) (mycolyl transferase 85C) (fibronectin-binding protein C)
  • updated information (H37Rv4):
    • gene name: fbpC
    • function:
    • reference:
• Type: Not Target
• Start: 156578
• End: 157600
• Operon:


• Trans-membrane region:
  
• Role: I.H.3 - Acyltransferases, Mycoloyltransferases, and phospholipid synthesis
• GO terms:
  • GO:0071769 - mycolate cell wall layer assembly (Uniprot)
  • GO:0050348 - trehalose O-mycolyltransferase activity (Uniprot)
  • GO:0046677 - response to antibiotic (Uniprot)
  • GO:0035375 - zymogen binding (Uniprot)
  • GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups (Uniprot)
  • GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0009247 - glycolipid biosynthetic process (Uniprot)
  • GO:0006869 - lipid transport (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0004144 - diacylglycerol O-acyltransferase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 0.522 TREHALOSEMONOMYCOLATE_40_CY_41_[c] -> 0.522 TRE[c] + TREHALOSEDIMYCOLATE[c]
  • 0.008 ARABINOGALACTAN_PEPTIDOGLYCAN[c] + 0.238 TREHALOSEMONOMYCOLATE[c] -> 0.238 TRE[c] + MAPC[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3hrh, 1va5, 1dqz, 1dqy
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5VNS	100%	Mycobacterium tuberculosis	M.tb Antigen 85C Acyl-Enzyme Intermediate with Tetrahydrolipstatin
  5OCJ	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Ag85C bound to cyclophostin 8beta inhibitor
  5KWJ	100%	Mycobacterium tuberculosis	M.tb Ag85C modified at C209 by amino-ebselen
  5KWI	100%	Mycobacterium tuberculosis	M.tb Ag85C modified at C209 by adamantyl-ebselen
  4QDT	100%	Mycobacterium tuberculosis	Crystal structure of Antigen 85C co-crystallized with iodoacetamide
  4MQM	100%	Mycobacterium tuberculosis	Crystal structure of Antigen 85C in presence of Ebselen
  3HRH	100%	Mycobacterium tuberculosis	Crystal Structure of Antigen 85C and Glycerol
  1VA5	100%	Mycobacterium tuberculosis	Antigen 85C with octylthioglucoside in active site
  4QEK	99%	Mycobacterium tuberculosis	Crystal structure of Antigen 85C-S124A mutant
  4QE3	99%	Mycobacterium tuberculosis	Crystal structure of Antigen 85C-H260Q mutant

• Links to additional information on fbpC:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.097 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTP
AFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPS
EGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.13 (0.2)	1.59 (0.47)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link