TB Genome Annotation Portal

Rv0129c (fbpC)

Amino Acid Sequence

MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTP
AFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPS
EGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.13 (0.2)1.59 (0.47)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0129c/fbpC, gene len: 1022 bp, num TA sites: 28
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=2.76)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.312)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.14)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0129c (fbpC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv2069priti.prietyIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    InteractionRegulatory Rv2069ashwinigbhatIEPCo-expression (Functional linkage)
    R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
    CitationPathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005prabhakarsmailIPI15653820structural analysis
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPIstructural analysis
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPIstructural analysis
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPIstructural analysis
    authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPIstructural analysis
    authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
    CitationDiagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Scand. J. Immunol. 2008prabhakarsmailIPI18702747structural analysis
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPIstructural analysis
    authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPIstructural analysis
    authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
    CitationA role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi BMC Biol. 2010prabhakarsmailIPI20100315structural analysis
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPIstructural analysis
    authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPIstructural analysis
    authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPISpectrophometric assay
    authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
    CitationPathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005prabhakarsmailIPI15653820Spectrophometric assay
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPISpectrophometric assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPISpectrophometric assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    CitationCrystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Nat. Struct. Biol. 2000prabhakarsmailIPI10655617structural analysis
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPIstructural analysis
    authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPIstructural analysis
    authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
    CitationImmunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Vaccine 1997prabhakarsmailIPI9234526structural analysis
    CitationImmunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Vaccine 1997prabhakarsmailIPI9234526Spectrophometric assay
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPISpectrophometric assay
    authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPISpectrophometric assay
    authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
    CitationDiagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Scand. J. Immunol. 2008prabhakarsmailIPI18702747Spectrophometric assay
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPISpectrophometric assay
    authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPISpectrophometric assay
    authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
    CitationA role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi BMC Biol. 2010prabhakarsmailIPI20100315Spectrophometric assay
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPISpectrophometric assay
    authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
    CitationCrystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Nat. Struct. Biol. 2000prabhakarsmailIPI10655617Spectrophometric assay
    InteractionPhysicalInteraction Rv3804cprabhakarsmailIPISpectrophometric assay
    authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
    InteractionPhysicalInteraction Rv1886cprabhakarsmailIPISpectrophometric assay
    authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
    InteractionRegulatedBy Rv0348yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    Namemycolyltransferase 85C; INVOLVED IN CELL WALL MYCOLOYLATIONmjacksonIMPMycolic acid processing
    Namemycolyltransferase 85C; INVOLVED IN CELL WALL MYCOLOYLATIONmjacksonIDAMycolic acid processing
    SymbolAg85CjlewTat substrate. Demonstrated by experimental verification that four secreted proteins from Mtb carrying putative Tat signals are bona fide Tat substrates
    M. Marrichi, L. Camacho et al. Genetic Toggling of Alkaline Phosphatase Folding Reveals Signal Peptides for All Major Modes of Transport across the Inner Membrane of Bacteria. J. Biol. Chem. 2008
    CitationGenetic Toggling of Alkaline Phosphatase Folding Reveals Signal Peptides for All Major Modes of Transport across the Inner Membrane of Bacteria. M. Marrichi, L. Camacho et al. J. Biol. Chem. 2008jlew18819916Tat substrate. Demonstrated by experimental verification that four secreted proteins from Mtb carrying putative Tat signals are bona fide Tat substrates
    CitationBiosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001jjmcfadden11555614Inferred from direct assay
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRjjmcfaddenNRInferred from direct assay
    authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
    TermEC:2.3.1.122 Trehalose O-mycolyltransferase. - NRextern:JZUCKERNRReaction blocked in mutant
    authors,M. Jackson,C. Raynaud,MA. Lanelle,C. Guilhot,C. Laurent-Winter,D. Ensergueix,B. Gicquel,M. Daff Inactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope. Mol. Microbiol. 1999
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRextern:JZUCKERNRReaction blocked in mutant
    authors,M. Jackson,C. Raynaud,MA. Lanelle,C. Guilhot,C. Laurent-Winter,D. Ensergueix,B. Gicquel,M. Daff Inactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope. Mol. Microbiol. 1999
    CitationRole of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Science 1997extern:JZUCKER9162010Assay of protein purified to homogeneity from its native host
    TermEC:2.3.1.122 Trehalose O-mycolyltransferase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
    CitationEvidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. V. Puech, C. Guilhot et al. Mol. Microbiol. 2002extern:JZUCKER12010501Inferred from experiment
    TermEC:2.3.1.122 Trehalose O-mycolyltransferase. - NRextern:JZUCKERNRInferred from experiment
    V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
    TermEC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NRextern:JZUCKERNRInferred from experiment
    V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
    CitationInactivation of the antigen 85C gene profoundly affects the mycolate content and alters the permeability of the Mycobacterium tuberculosis cell envelope. authors,M. Jackson,C. Raynaud,MA. Lanelle,C. Guilhot,C. Laurent-Winter,D. Ensergueix,B. Gicquel,M. Daff Mol. Microbiol. 1999extern:JZUCKER10200974Reaction blocked in mutant

    Comments