TB Genome Annotation Portal

Rv0097 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: oxidoreductase
  • REFSEQ: oxidoreductase
  • PATRIC: Oxidoreductase
  • TUBERCULIST: Possible oxidoreductase
  • NCBI: Possible oxidoreductase
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 106734
• End: 107603
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0051213 - dioxygenase activity (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6L6X	45%	Streptomyces coeruleorubidus	The structure of ScoE with substrate
  6L6W	45%	Streptomyces coeruleorubidus	The structure of ScoE with intermediate
  6DCH	45%	Streptomyces coeruleorubidus	Structure of isonitrile biosynthesis enzyme ScoE
  6L86	42%	Streptomyces thioluteus	The structure of SfaA

• Links to additional information on Rv0097:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.565 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDVHPSPREFIKLGRIIGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDY
MFMPEPFAFSMVLPLAVPGHDRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSDVYRPIGEVWDEINRTTPPIKWPTVIRHPKTGQEILYI
CATGTTKIEDKDGNPVDPEVLQELMAATGQLDPEYQSPFIHTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDGLKTPGYAA

Additional Information