TB Genome Annotation Portal

Rv0097 (-)

Amino Acid Sequence

MTLKVKGEGLGAQVTGVDPKNLDDITTDEIRDIVYTNKLVVLKDVHPSPREFIKLGRIIGQIVPYYEPMYHHEDHPEIFVSSTEEGQGVPKTGAFWHIDY
MFMPEPFAFSMVLPLAVPGHDRGTYFIDLARVWQSLPAAKRDPARGTVSTHDPRRHIKIRPSDVYRPIGEVWDEINRTTPPIKWPTVIRHPKTGQEILYI
CATGTTKIEDKDGNPVDPEVLQELMAATGQLDPEYQSPFIHTQHYQVGDIILWDNRVLMHRAKHGSAAGTLTTYRLTMLDGLKTPGYAA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 26 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 26 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 26 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 26 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 26 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.82
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0097 (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionTranscription Rv0102gaurisd10IEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0098ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0098ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0098ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0102ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    CitationMycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006ashwinigbhatIEP17028284Microarray Analysis
    InteractionRegulatory Rv3911ashwinigbhatIEPMicroarray Analysis
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    CitationIdentification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. F. Wang, R. Langley et al. Chem. Biol. 2007ashwinigbhatIEP17524985Microarray Analysis
    InteractionRegulatory Rv3911ashwinigbhatIEPMicroarray Analysis
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0102ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    CitationThe structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. King-Scott, E. Nowak et al. J. Biol. Chem. 2007ashwinigbhatIEP17942407Coexpression
    InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0098ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0102ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    CitationIdentification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. F. Wang, R. Langley et al. Chem. Biol. 2007ashwinigbhatIEP17524985Coexpression
    InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0098ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    CitationThe senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. T. Parish, DA. Smith et al. Microbiology (Reading, Engl.) 2003ashwinigbhatIEP12777483Microarray Analysis
    InteractionRegulatory Rv0491ashwinigbhatIEPMicroarray Analysis
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    CitationIdentification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. F. Wang, R. Langley et al. Chem. Biol. 2007ashwinigbhatIEP17524985Microarray Analysis
    InteractionRegulatory Rv0491ashwinigbhatIEPMicroarray Analysis
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    CitationThe senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. T. Parish, DA. Smith et al. Microbiology (Reading, Engl.) 2003ashwinigbhatIEP12777483Coexpression
    InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0098ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003

    Comments