TB Genome Annotation Portal

Rv0055 (rpsR1)

Amino Acid Sequence

MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0055/rpsR1, gene len: 254 bp, num TA sites: 5
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-3.42)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.385)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-3.76)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.29 (0.46)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv0055/rpsR1Rv0023/-1.57
    Rv0055/rpsR1Rv0238/fdmR-1.31
    Rv0055/rpsR1Rv1358/--1.57
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0055 (rpsR1)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv0056vmevada102ISOOperon (Functional Linkage)
    authors,DW. Hoffman,C. Davies,SE. Gerchman,JH. Kycia,SJ. Porter,SW. White,V. Ramakrishnan Crystal structure of prokaryotic ribosomal protein L9: a bi-lobed RNA-binding protein. EMBO J. 1994
    InteractionPhysicalInteraction Rv0053vmevada102ISOOperon (Functional Linkage)
    authors,N. Ban,P. Nissen,J. Hansen,M. Capel,PB. Moore,TA. Steitz Placement of protein and RNA structures into a 5 A-resolution map of the 50S ribosomal subunit. Nature 1999
    InteractionPhysicalInteraction Rv0056vmevada102ISOOperon (Functional Linkage)
    authors,N. Ban,P. Nissen,J. Hansen,M. Capel,PB. Moore,TA. Steitz Placement of protein and RNA structures into a 5 A-resolution map of the 50S ribosomal subunit. Nature 1999
    CitationThe nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. authors,J. Schnier,M. Kitakawa,K. Isono Mol. Gen. Genet. 1986vmevada102ISO3528756Operon (Functional Linkage)
    InteractionPhysicalInteraction Rv0053vmevada102ISOOperon (Functional Linkage)
    authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
    InteractionPhysicalInteraction Rv0056vmevada102ISOOperon (Functional Linkage)
    authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
    InteractionPhysicalInteraction Rv0056vmevada102ISOOperon (Functional Linkage)
    authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
    InteractionPhysicalInteraction Rv0053singhpankaj2116ISOOperon (Functional linkage)
    PR. Jungblut, UE. Schaible et al. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Mol. Microbiol. 1999
    InteractionPhysicalInteraction Rv0053singhpankaj2116ISOOperon (Functional linkage)
    authors,J. Schnier,M. Kitakawa,K. Isono The nucleotide sequence of an Escherichia coli chromosomal region containing the genes for ribosomal proteins S6, S18, L9 and an open reading frame. Mol. Gen. Genet. 1986
    CitationPlacement of protein and RNA structures into a 5 A-resolution map of the 50S ribosomal subunit. authors,N. Ban,P. Nissen,J. Hansen,M. Capel,PB. Moore,TA. Steitz Nature 1999vmevada102ISO10476961Operon (Functional Linkage)
    InteractionPhysicalInteraction Rv0053singhpankaj2116ISOOperon (Functional linkage)
    authors,K. Isono,M. Kitakawa Cluster of ribosomal protein genes in Escherichia coli containing genes for proteins S6, S18, and L9. Proc. Natl. Acad. Sci. U.S.A. 1978
    InteractionPhysicalInteraction Rv0053singhpankaj2116ISOOperon (Functional linkage)
    HJ. Mollenkopf, PR. Jungblut et al. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Electrophoresis 1999

    Comments