TB Genome Annotation Portal

Rv0055 (rpsR1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 30S ribosomal protein S18 1
  • REFSEQ: 30S ribosomal protein S18
  • PATRIC: SSU ribosomal protein S18p @ SSU ribosomal protein S18p zinc-dependent
  • TUBERCULIST: 30S ribosomal protein S18-1 RpsR1
  • NCBI: 30S ribosomal protein S18-1 RpsR1
  • updated information (H37Rv4):
    • gene name: rpsR1
    • function:
    • reference:
• Type: Not Target
• Start: 59122
• End: 59376
• Operon:


• Trans-membrane region:
  
• Role: II.A.1 - Ribosomal protein synthesis and modification
• GO terms:
  • GO:0030529 - not-found (Uniprot)
  • GO:0022627 - cytosolic small ribosomal subunit (Uniprot)
  • GO:0019843 - rRNA binding (Uniprot)
  • GO:0006412 - translation (Uniprot)
  • GO:0005840 - ribosome (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0003735 - structural constituent of ribosome (Uniprot)
  • GO:0003723 - RNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5V93	100%	Mycobacterium tuberculosis	Cryo-EM structure of the 70S ribosome from Mycobacterium tuberculosis bound with Capreomycin
  5ZEU	91%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	M. smegmatis P/P state 30S ribosomal subunit
  5ZEP	91%	Mycobacterium smegmatis str. MC2 155	M. smegmatis hibernating state 70S ribosome structure
  5ZEB	91%	Mycobacterium smegmatis str. MC2 155	M. Smegmatis P/P state 70S ribosome structure
  5XYU	91%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Small subunit of Mycobacterium smegmatis ribosome
  5O61	91%	Mycobacterium smegmatis str. MC2 155	The complete structure of the Mycobacterium smegmatis 70S ribosome
  5O5J	91%	Mycobacterium smegmatis str. MC2 155	Structure of the 30S small ribosomal subunit from Mycobacterium smegmatis
  6WUB	59%	Enterococcus faecalis OG1RF	30S subunit (head) of 70S Ribosome Enterococcus faecalis MultiBody refinement
  6W6P	59%	Enterococcus faecalis OG1RF	MultiBody Refinement of 70S Ribosome from Enterococcus faecalis
  6O90	59%	Enterococcus faecalis	Cryo-EM image reconstruction of the 70S Ribosome Enterococcus faecalis Class05

• Links to additional information on rpsR1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -10.938 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR

Additional Information