TB Genome Annotation Portal

Rv0047c (-)

Amino Acid Sequence

MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADGLIAENAAPAGTPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVH
LAFFNRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWLNELIAAERAAPNPAEQT
(Nucleotide sequence available on KEGG)

Additional Information

NapM - nucleoid-binding protein
Liu et al (2019). NapM enhances the survival of Mycobacterium tuberculosis under stress and in macrophages. Comm Biol.
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6377630/

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 7 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 7 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 7 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 8 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000050;
5 non-insertions in a row out of 8 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 2.21
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv0047c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionOperon Rv0048cpriti.prietyIDAStructural Analysis
    F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDAStructural Analysis
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionOperon Rv0048cpriti.prietyIDASpectrophotometric
    F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDASpectrophotometric
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    InteractionOperon Rv0048cpriti.prietyIDAStructural Analysis
    N. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
    CitationCloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Appl. Environ. Microbiol. 2004priti.prietyIDA15066807Structural Analysis
    InteractionOperon Rv0046cpriti.prietyIDAStructural Analysis
    authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDAStructural Analysis
    authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDASpectrophotometric
    N. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
    CitationThe Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. F. Movahedzadeh, DA. Smith et al. Mol. Microbiol. 2004priti.prietyIDA14763976Spectrophotometric
    InteractionOperon Rv0046cpriti.prietyIDASpectrophotometric
    F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDASpectrophotometric
    F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
    CitationCloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Appl. Environ. Microbiol. 2004priti.prietyIDA15066807Spectrophotometric
    InteractionOperon Rv0046cpriti.prietyIDASpectrophotometric
    authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDASpectrophotometric
    authors,J. Gury,L. Barthelmebs,NP. Tran,C. Divis,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
    CitationThe Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. F. Movahedzadeh, DA. Smith et al. Mol. Microbiol. 2004priti.prietyIDA14763976Structural Analysis
    InteractionOperon Rv0046cpriti.prietyIDAStructural Analysis
    F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
    InteractionOperon Rv0048cpriti.prietyIDAStructural Analysis
    F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
    InteractionRegulatedBy Rv0981yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006

    Comments