TB Genome Annotation Portal

Rv3921c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: membrane protein oxaA
  • REFSEQ: putative inner membrane protein translocase component YidC
  • PATRIC: Inner membrane protein translocase component YidC long form
  • TUBERCULIST: Probable conserved transmembrane protein
  • NCBI: Probable conserved transmembrane protein
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Essential
• Start: 4408969
• End: 4410069
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0051205 - protein insertion into membrane (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015031 - protein transport (Uniprot)
  • GO:0005887 - integral component of plasma membrane (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0043022 - ribosome binding (FLUTE) (FLUTE Assigned!Y2 report, pull-down)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6AL2	36%	Escherichia coli	Crystal structure of E. coli YidC at 2.8 A resolution
  5MG3	36%	Escherichia coli	EM fitted model of bacterial holo-translocon
  5M5H	36%	Escherichia coli	RIBOSOME-BOUND YIDC INSERTASE
  4UTQ	36%	ESCHERICHIA COLI	A structural model of the active ribosome-bound membrane protein insertase YidC
  3WVF	36%	Escherichia coli	Crystal structure of YidC from Escherichia coli
  5Y83	35%	Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)	Crystal structure of YidC from Thermotoga maritima

• Links to additional information on Rv3921c:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -8.476 (from Jeremy Rock's lab)

Amino Acid Sequence

VSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQRE
HGFNPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVGHFLDANLFGAPIGAYMTQRSGLDAFVDFSRPALIAVGVPV
MILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVFPLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPG
AKPKRSPKTAPATNAAAPTEAGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVRPKKRKR

Additional Information