Rv3911 (sigM)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: sigma-70 family RNA polymerase sigma factor
- REFSEQ: RNA polymerase sigma factor SigM
- PATRIC: RNA polymerase sigma-70 factor ECF subfamily
- TUBERCULIST: Possible alternative RNA polymerase sigma factor SigM
- NCBI: Possible alternative RNA polymerase sigma factor SigM
- updated information (H37Rv4):
  - gene name: sigM
  - function:
  - reference:
Type: Not Target
Start: 4400186
End: 4400854
Operon:

Trans-membrane region:
Role: II.A.7 - RNA synthesis, RNA modification and DNA transcription
GO terms:
- GO:2000142 - regulation of DNA-templated transcription, initiation (Uniprot)
- GO:0045893 - positive regulation of transcription, DNA-templated (Uniprot)
- GO:0016987 - bacterial sigma factor activity (Uniprot)
- GO:0009415 - response to water (Uniprot)
- GO:0009410 - response to xenobiotic stimulus (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006352 - DNA-templated transcription, initiation (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0003700 - DNA binding transcription factor activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
4LUP	38%	Escherichia coli	Crystal structure of the complex formed by region of E. coli sigmaE bound to its -10 element non template strand
2MAP	38%	Escherichia coli	Solution structure of the complex formed by the region 2 of E. coli sigmaE and its cognate -10 promoter element non template strand TGTCAAA.
2MAO	38%	Escherichia coli	NMR structure of region 2 of E. coli sigmaE
6JBQ	36%	Escherichia coli (strain K12)	CryoEM structure of Escherichia coli sigmaE transcription initiation complex containing 5nt of RNA
1OR7	36%	Escherichia coli	Crystal Structure of Escherichia coli sigmaE with the Cytoplasmic Domain of its Anti-sigma RseA
5OR5	35%	Escherichia coli (strain K12)	NMR structure of the complex formed by an engineered region 2 of sigmaE in complex with GTAAAA

Links to additional information on sigM:
- TBDB (updated)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MPPPIGYCPAVGFGGRHERSDAELLAAHVAGDRYAFDQLFRRHHRQLHRLARLTSRTSEDADDALQDAMLSAHRGAGSFRYDAAVSSWLHRIVVNACLDR
LRRAKAHPTAPLEDVYPVADRTAQVETAIAVQRALMRLPVEQRAAVVAVDMQGYSIADTRPDAGRGRGHRQEPLRPGAGPPSAAAGLSQHRGEHPALTPL
PVRRSIDPRARRYPTSGYCHRA

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 12 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 2.4
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv2515c (-) (Direct binding)
- Rv3906c (-) (Direct binding)
- Rv2514c (-) (Upstream of operon)
Bound By:
- Rv0047c (-) (Direct binding)
- Rv0081 (-) (Upstream of operon)
- Rv3219 (whiB1) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
Upregulated by:
- Rv0022c (whiB5)
- Rv3911 (sigM)
Downregulates:
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3911 (sigM)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Transcription Rv3912	sourish10	IEP		Co-expression (Functional linkage) authors,JG. Sklar,H. Makinoshima,JS. Schneider,MS. Glickman M. tuberculosis intramembrane protease Rip1 controls transcription through three anti-sigma factor substrates. Mol. Microbiol. 2010
Interaction	Transcription Rv3906c	sourish10	IEP		Co-expression (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	Transcription Rv3906c	sourish10	IEP		Co-expression (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	Transcription Rv3906c	sourish10	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv3906c	sourish10	IEP		Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Transcription Rv3905c	sourish10	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv3905c	sourish10	IEP		Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Transcription Rv3905c	sourish10	IEP		Co-expression (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	Transcription Rv3905c	sourish10	IEP		Co-expression (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	Transcription Rv3904c	sourish10	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv3904c	sourish10	IEP		Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Transcription Rv3904c	sourish10	IEP		Co-expression (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	Transcription Rv3904c	sourish10	IEP		Co-expression (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	Regulatory Rv3448	yashabhasin	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulates Rv3449	harsharohiratruefriend	IEP		Co-expression (Functional linkage) GD. Brown, JA. Dave et al. The mycosins of Mycobacterium tuberculosis H37Rv: a family of subtilisin-like serine proteases. Gene 2000
Interaction	Regulates Rv3449	harsharohiratruefriend	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulates Rv3449	harsharohiratruefriend	IEP		Co-expression (Functional linkage) JA. Dave, NC. Gey van Pittius et al. Mycosin-1, a subtilisin-like serine protease of Mycobacterium tuberculosis, is cell wall-associated and expressed during infection of macrophages. BMC Microbiol. 2002
Interaction	Regulatory Rv3443c	priyadarshinipriyanka2001	NAS		Co-expression (Functional linkage) S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulates Rv3444c	chirupolo	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulates Rv3445c	diponlove	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulatory Rv3447c	yashabhasin	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulatory Rv3439c	ranjeetsingh	IEP		Co-expression(Functional Linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulatory Rv3440c	chirupolo	IEP		Co-expression(Functional Linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulatory Rv3442c	priyadarshinipriyanka2001	NAS		Co-expression (Functional linkage) S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Transcription Rv3235	sourish10	IEP		Co-expression (Functional linkage) S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv3092c	shahanup86	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulatory Rv3093c	shahanup86	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv0479c	sourish10	IEP		Co-expression (Functional linkage) PA. Fontn, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008
Interaction	Transcription Rv0479c	sourish10	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulatory Rv0313	vizhi.gurusamy	NAS		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Transcription Rv0237	sourish10	IEP		Co-expression (Functional linkage) S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0101	gaurisd10	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0101	gaurisd10	IEP		Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0101	gaurisd10	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0100	ashwinigbhat	IEP		Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0100	ashwinigbhat	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0099	ashwinigbhat	IEP		Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0099	ashwinigbhat	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0098	ashwinigbhat	IEP		Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0098	ashwinigbhat	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0097	ashwinigbhat	IEP		Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0097	ashwinigbhat	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0096	ashwinigbhat	IEP		Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0096	ashwinigbhat	IEP		Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv0035	priti.priety	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3907c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulates Rv3443c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3444c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3904c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3905c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3396c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3422c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3439c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1361c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1457c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2514c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulates Rv3825c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0098	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0099	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0100	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3137	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3478	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3616c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3134c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3135	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3136	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulates Rv2938	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2940c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3130c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3131	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2933	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2934	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2935	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2524c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2931	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2932	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulates Rv0885	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1180	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2246	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2247	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Citation	Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006	yamir.moreno	IEP	17028284	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3905c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3906c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	RegulatedBy Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulates Rv3904c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3904c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3905c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3445c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3449	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3444c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3444c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3445c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3093c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3439c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3440c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	Regulates Rv0313	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0479c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0685	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3092c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0035	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	yamir.moreno	IEP	17088352	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Transcription Rv3912

sourish10

IEP

Co-expression (Functional linkage)
authors,JG. Sklar,H. Makinoshima,JS. Schneider,MS. Glickman M. tuberculosis intramembrane protease Rip1 controls transcription through three anti-sigma factor substrates. Mol. Microbiol. 2010

Interaction

Transcription Rv3906c

sourish10

IEP

Co-expression (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

Transcription Rv3906c

sourish10

IEP

Co-expression (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

Transcription Rv3906c

sourish10

IEP

Co-expression (Functional linkage)
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

Transcription Rv3906c

sourish10

IEP

Co-expression (Functional linkage)
authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002

Interaction

Transcription Rv3905c

sourish10

IEP

Interaction

Transcription Rv3905c

sourish10

IEP

Interaction

Transcription Rv3905c

sourish10

IEP

Co-expression (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

Transcription Rv3905c

sourish10

IEP

Co-expression (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

Transcription Rv3904c

sourish10

IEP

Interaction

Transcription Rv3904c

sourish10

IEP

Interaction

Transcription Rv3904c

sourish10

IEP

Co-expression (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

Transcription Rv3904c

sourish10

IEP

Co-expression (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

Regulatory Rv3448

yashabhasin

IEP

Interaction

Regulates Rv3449

harsharohiratruefriend

IEP

Co-expression (Functional linkage)
GD. Brown, JA. Dave et al. The mycosins of Mycobacterium tuberculosis H37Rv: a family of subtilisin-like serine proteases. Gene 2000

Interaction

Regulates Rv3449

harsharohiratruefriend

IEP

Interaction

Regulates Rv3449

harsharohiratruefriend

IEP

Co-expression (Functional linkage)
JA. Dave, NC. Gey van Pittius et al. Mycosin-1, a subtilisin-like serine protease of Mycobacterium tuberculosis, is cell wall-associated and expressed during infection of macrophages. BMC Microbiol. 2002

Interaction

Regulatory Rv3443c

priyadarshinipriyanka2001

NAS

Co-expression (Functional linkage)
S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006

Interaction

Regulates Rv3444c

chirupolo

IEP

Interaction

Regulates Rv3445c

diponlove

IEP

Interaction

Regulatory Rv3447c

yashabhasin

IEP

Interaction

Regulatory Rv3439c

ranjeetsingh

IEP

Co-expression(Functional Linkage)
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

Regulatory Rv3440c

chirupolo

IEP

Interaction

Regulatory Rv3442c

priyadarshinipriyanka2001

NAS

Interaction

Transcription Rv3235

sourish10

IEP

Interaction

Regulatory Rv3092c

shahanup86

IEP

Interaction

Regulatory Rv3093c

shahanup86

IEP

Interaction

Transcription Rv0479c

sourish10

IEP

Co-expression (Functional linkage)
PA. Fontn, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008

Interaction

Transcription Rv0479c

sourish10

IEP

Interaction

Regulatory Rv0313

vizhi.gurusamy

NAS

Interaction

Transcription Rv0237

sourish10

IEP

Interaction

Regulatory Rv0101

gaurisd10

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0101

gaurisd10

IEP

Microarray Analysis
S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006

Interaction

Regulatory Rv0101

gaurisd10

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0100

ashwinigbhat

IEP

Interaction

Regulatory Rv0100

ashwinigbhat

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0099

ashwinigbhat

IEP

Interaction

Regulatory Rv0099

ashwinigbhat

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0098

ashwinigbhat

IEP

Interaction

Regulatory Rv0098

ashwinigbhat

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0097

ashwinigbhat

IEP

Interaction

Regulatory Rv0097

ashwinigbhat

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0096

ashwinigbhat

IEP

Microarray Analysis
F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007

Interaction

Regulatory Rv0096

ashwinigbhat

IEP

Interaction

Regulatory Rv0035

priti.priety

IEP

Citation

Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3907c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006

Interaction

Regulates Rv3443c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3444c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3904c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3905c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3396c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3422c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3439c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv1361c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv1457c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2514c

yamir.moreno

IEP

Interaction

Regulates Rv3825c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv0098

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv0099

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv0100

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3137

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3478

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3616c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3134c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3135

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3136

yamir.moreno

IEP

Interaction

Regulates Rv2938

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2940c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3130c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv3131

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2933

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2934

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2935

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2524c

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2931

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2932

yamir.moreno

IEP

Interaction

Regulates Rv0885

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv1180

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2246

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Interaction

Regulates Rv2247

yamir.moreno

IEP

Citation

yamir.moreno

IEP

17028284

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3905c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3906c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3911

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

RegulatedBy Rv3911

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

Regulates Rv3904c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3904c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3905c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3445c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3449

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3444c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3444c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3445c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3093c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3439c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3440c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

Regulates Rv0313

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv0479c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv0685

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv3092c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Interaction

Regulates Rv0035

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

yamir.moreno

IEP

17088352

Comments