Rv3905c (esxF)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: WXG100 family type VII secretion target
- REFSEQ: hypothetical protein
- PATRIC: Esat-6 like protein EsxF
- TUBERCULIST: Putative ESAT-6 like protein EsxF (hypothetical alanine and glycine rich protein) (ESAT-6 like protein 13)
- NCBI: Putative ESAT-6 like protein EsxF (hypothetical alanine and glycine rich protein) (ESAT-6 like protein 13)
- updated information (H37Rv4):
  - gene name: esxF
  - function:
  - reference:
Type: Not Target
Start: 4390720
End: 4391031
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on esxF:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.406 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MGADDTLRVEPAVMQGFAASLDGAAEHLAVQLAELDAQVGQMLGGWRGASGSAYGSAWELWHRGAGEVQLGLSMLAAAIAHAGAGYQHNETASAQVLREV
GGG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 5 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 5 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 5 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 5 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 5 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.43
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0022c (whiB5)
- Rv3911 (sigM)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0047c (-)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3905c (esxF)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	PhysicalInteraction Rv3906c	sourish10	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3906c	sourish10	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	sourish10	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	Transcription Rv3911	sourish10	IEP		Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002	sourish10	IEP	11940590	Co-expression (Functional linkage)
Interaction	Transcription Rv3911	sourish10	IEP		Co-expression (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3906c	sourish10	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Citation	Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002	kaveri.verma	TAS	11940590	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3906c	kaveri.verma	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Citation	The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002	sourish10	IEP	11973144	Co-expression (Functional linkage)
Interaction	Transcription Rv3911	sourish10	IEP		Co-expression (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Citation	Antigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001	sourish10	IEP	11669220	Co-expression (Functional linkage)
Interaction	Transcription Rv3911	sourish10	IEP		Co-expression (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	sourish10	IEP	17088352	Co-expression (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3906c	kaveri.verma	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Citation	Antigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001	kaveri.verma	TAS	11669220	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3906c	kaveri.verma	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	kaveri.verma	TAS	17088352	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	kaveri.verma	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007	shahanup86	TAS	17088352	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3906c	shahanup86	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Citation	Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002	shahanup86	TAS	11940590	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3906c	shahanup86	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Citation	The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002	kaveri.verma	TAS	11973144	Operon (Functional linkage)
Citation	The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002	shahanup86	TAS	11973144	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3906c	shahanup86	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Citation	Antigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001	shahanup86	TAS	11669220	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3906c	shahanup86	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	PhysicalInteraction Rv3904c	kaveri.verma	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
Interaction	PhysicalInteraction Rv3904c	shahanup86	TAS		Operon (Functional linkage) authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
Interaction	RegulatedBy Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	RegulatedBy Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Property

Value

Creator

Evidence

PMID

Comment

Interaction

PhysicalInteraction Rv3906c

sourish10

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

PhysicalInteraction Rv3906c

sourish10

TAS

Operon (Functional linkage)
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

PhysicalInteraction Rv3906c

sourish10

TAS

Operon (Functional linkage)
authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002

Interaction

Transcription Rv3911

sourish10

IEP

Co-expression (Functional linkage)
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Citation

Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002

sourish10

IEP

11940590

Co-expression (Functional linkage)

Interaction

Transcription Rv3911

sourish10

IEP

Co-expression (Functional linkage)
authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002

Interaction

PhysicalInteraction Rv3906c

sourish10

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Citation

kaveri.verma

TAS

11940590

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Interaction

PhysicalInteraction Rv3906c

kaveri.verma

TAS

Citation

The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002

sourish10

IEP

11973144

Co-expression (Functional linkage)

Interaction

Transcription Rv3911

sourish10

IEP

Co-expression (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Citation

Antigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001

sourish10

IEP

11669220

Co-expression (Functional linkage)

Interaction

Transcription Rv3911

sourish10

IEP

Co-expression (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

sourish10

IEP

17088352

Co-expression (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

PhysicalInteraction Rv3906c

kaveri.verma

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Citation

Antigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001

kaveri.verma

TAS

11669220

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

PhysicalInteraction Rv3906c

kaveri.verma

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

kaveri.verma

TAS

17088352

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Interaction

PhysicalInteraction Rv3906c

kaveri.verma

TAS

Citation

Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007

shahanup86

TAS

17088352

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Interaction

PhysicalInteraction Rv3906c

shahanup86

TAS

Citation

shahanup86

TAS

11940590

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Interaction

PhysicalInteraction Rv3906c

shahanup86

TAS

Citation

The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002

kaveri.verma

TAS

11973144

Operon (Functional linkage)

Citation

The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002

shahanup86

TAS

11973144

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

PhysicalInteraction Rv3906c

shahanup86

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Citation

Antigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001

shahanup86

TAS

11669220

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

PhysicalInteraction Rv3906c

shahanup86

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

PhysicalInteraction Rv3904c

kaveri.verma

TAS

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Operon (Functional linkage)
MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002

Interaction

PhysicalInteraction Rv3904c

shahanup86

TAS

Operon (Functional linkage)
authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001

Interaction

RegulatedBy Rv3911

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006

Interaction

RegulatedBy Rv3911

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Interaction

RegulatedBy Rv3911

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

Comments