TB Genome Annotation Portal

Rv3904c (esxE)

Amino Acid Sequence

VDPTVLADAVARMAEFGRHVEELVAEIESLVTRLHVTWTGEGAAAHAEAQRHWAAGEAMMRQALAQLTAAGQSAHANYTGAMATNLGMWS
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.72 (0.3)2.14 (0.98)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 3 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 3 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 3 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 3 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 3 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.94
Uncertain 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3904c (esxE)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv3906csourish10TASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionPhysicalInteraction Rv3906csourish10TASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    InteractionPhysicalInteraction Rv3906csourish10TASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    InteractionPhysicalInteraction Rv3906csourish10TASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    InteractionTranscription Rv3911sourish10IEPCo-expression (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    CitationConclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002sourish10IEP11940590Co-expression (Functional linkage)
    InteractionTranscription Rv3911sourish10IEPCo-expression (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    CitationConclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002kaveri.vermaTAS11940590Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    InteractionPhysicalInteraction Rv3906ckaveri.vermaTASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    CitationThe ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002sourish10IEP11973144Co-expression (Functional linkage)
    InteractionTranscription Rv3911sourish10IEPCo-expression (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    CitationAntigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001sourish10IEP11669220Co-expression (Functional linkage)
    InteractionTranscription Rv3911sourish10IEPCo-expression (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    CitationCharacterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007sourish10IEP17088352Co-expression (Functional linkage)
    CitationThe ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002kaveri.vermaTAS11973144Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    InteractionPhysicalInteraction Rv3906ckaveri.vermaTASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    CitationAntigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001kaveri.vermaTAS11669220Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    InteractionPhysicalInteraction Rv3906ckaveri.vermaTASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    CitationCharacterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007kaveri.vermaTAS17088352Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905ckaveri.vermaTASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionPhysicalInteraction Rv3906ckaveri.vermaTASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionPhysicalInteraction Rv3906cshahanup86TASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    CitationCharacterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. N. Agarwal, SC. Woolwine et al. Infect. Immun. 2007shahanup86TAS17088352Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionPhysicalInteraction Rv3906cshahanup86TASOperon (Functional linkage)
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    CitationConclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr J. Biol. Chem. 2002shahanup86TAS11940590Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    InteractionPhysicalInteraction Rv3906cshahanup86TASOperon (Functional linkage)
    authors,PS. Renshaw,P. Panagiotidou,A. Whelan,SV. Gordon,RG. Hewinson,RA. Williamson,MD. Carr Conclusive evidence that the major T-cell antigens of the Mycobacterium tuberculosis complex ESAT-6 and CFP-10 form a tight, 1:1 complex and characterization of the structural properties of ESAT-6, CFP-10, and the ESAT-6*CFP-10 complex. Implications for pathogenesis and virulence. J. Biol. Chem. 2002
    CitationThe ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? MJ. Pallen Trends Microbiol. 2002shahanup86TAS11973144Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    InteractionPhysicalInteraction Rv3906cshahanup86TASOperon (Functional linkage)
    MJ. Pallen The ESAT-6/WXG100 superfamily -- and a new Gram-positive secretion system? Trends Microbiol. 2002
    CitationAntigen discovery and tuberculosis vaccine development in the post-genomic era. authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Scand. J. Infect. Dis. 2001shahanup86TAS11669220Operon (Functional linkage)
    InteractionPhysicalInteraction Rv3905cshahanup86TASOperon (Functional linkage)
    authors,R. Louise,V. Skjt,EM. Agger,P. Andersen Antigen discovery and tuberculosis vaccine development in the post-genomic era. Scand. J. Infect. Dis. 2001
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007

    Comments