TB Genome Annotation Portal

Rv3873 (PPE68)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: PPE family protein
  • REFSEQ: PPE family protein
  • PATRIC: Putative ESX-1 secretion system gating protein PPE68
  • TUBERCULIST: PPE family protein PPE68
  • NCBI: PPE family protein PPE68
  • updated information (H37Rv4):
    • gene name: PPE68
    • function:
    • reference:
• Type: Conditional
• Start: 4351075
• End: 4352181
• Operon:


• Trans-membrane region:
  
• Role: IV.C.2 - PPE family
• GO terms:
  • GO:0016020 - membrane (Uniprot)
  • GO:0009986 - cell surface (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6VHR	50%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group I422
  6UUJ	50%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121
  5XFS	41%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis

• Links to additional information on PPE68:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.934 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MLWHAMPPELNTARLMAGAGPAPMLAAAAGWQTLSAALDAQAVELTARLNSLGEAWTGGGSDKALAAATPMVVWLQTASTQAKTRAMQATAQAAAYTQAM
ATTPSLPEIAANHITQAVLTATNFFGINTIPIALTEMDYFIRMWNQAALAMEVYQAETAVNTLFEKLEPMASILDPGASQSTTNPIFGMPSPGSSTPVGQ
LPPAATQTLGQLGEMSGPMQQLTQPLQQVTSLFSQVGGTGGGNPADEEAAQMGLLGTSPLSNHPLAGGSGPSAGAGLLRAESLPGAGGSLTRTPLMSQLI
EKPVAPSVMPAAAAGSSATGGAAPVGAGAMGQGAQSGGSTRPGLVAPAPLAQEREEDDEDDWDEEDDW

Additional Information

• collected by: Becky Audette (Rubin lab) (7/28/2015)
• SRA accession: PRJNA484233
• counts: TnSeq_PPE68_KO_H37Rv.wig
• reference: TnSeq_H37Rv_R96_H37Rv.wig
• resampling: resampling_PPE68_KO.xlsx