TB Genome Annotation Portal

Rv3870 (eccCa1)

Amino Acid Sequence

MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAMLGMIAIMVAGGTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINA
DRKEYLRYLAGLRTRVTSSATSQVAFFSYHAPHPEDLLSIVGTQRQWSRPANADFYAATRIGIGDQPAVDRLLKPAVGGELAAASAAPQPFLEPVSHMWV
VKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTAMICHLAVFHPPDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLS
DLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGSAYRIRVHEDGTADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITG
TILDKTSRVQKKVATDWHQLVGAQSVEEITPSRWRMYTDTDRDRLKIPFGHELKTGNVMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVAMT
HPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAELVSRMGEVLTGELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDE
FAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNLTYRIALRTTSSHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFY
ISGPYMPPAAGVETNGEAGGPGQQTTRQAARIHRFTAAPVLEEAPTP
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.005050;
6 non-insertions in a row out of 38 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 38 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 38 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 38 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 38 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.23
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3870 (eccCa1)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv3871shahanup86IMPCo-expression (Functional linkage)
    P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
    InteractionPhysicalInteraction Rv3871shahanup86IMPCo-expression (Functional linkage)
    A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
    CitationDissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. P. Brodin, L. Majlessi et al. Infect. Immun. 2006shahanup86IMP16368961Co-expression (Functional linkage)
    InteractionPhysicalInteraction Rv3869shahanup86IMPCo-expression (Functional linkage)
    P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
    InteractionPhysicalInteraction Rv3871shahanup86IMPCo-expression (Functional linkage)
    P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
    InteractionPhysicalInteraction Rv3877shahanup86IMPCo-expression (Functional linkage)
    P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
    InteractionPhysicalInteraction Rv3871shahanup86IMPCo-expression (Functional linkage)
    PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
    InteractionPhysicalInteraction Rv3869shahanup86IMPCo-expression (Functional linkage)
    A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
    CitationC-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. PA. Champion, SA. Stanley et al. Science 2006shahanup86IMP16973880Co-expression (Functional linkage)
    InteractionPhysicalInteraction Rv3869shahanup86IMPCo-expression (Functional linkage)
    PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
    InteractionPhysicalInteraction Rv3871shahanup86IMPCo-expression (Functional linkage)
    PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
    InteractionPhysicalInteraction Rv3877shahanup86IMPCo-expression (Functional linkage)
    PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
    InteractionPhysicalInteraction Rv3869shahanup86IMPCo-expression (Functional linkage)
    P. Brodin, L. Majlessi et al. Dissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. Infect. Immun. 2006
    InteractionPhysicalInteraction Rv2748cvizhi.gurusamyRCA
    authors,H. Rachman,M. Strong,T. Ulrichs,L. Grode,J. Schuchhardt,H. Mollenkopf,GA. Kosmiadi,D. Eisenberg,SH. Kaufmann Unique transcriptome signature of Mycobacterium tuberculosis in pulmonary tuberculosis. Infect. Immun. 2006
    CitationDissection of ESAT-6 system 1 of Mycobacterium tuberculosis and impact on immunogenicity and virulence. P. Brodin, L. Majlessi et al. Infect. Immun. 2006jlew16368961Essential for secretion of ESAT-6 and CFP-10

    Comments