Rv3849 (espR)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: ESX-1 secretion-associated regulator EspR
- REFSEQ: hypothetical protein
- PATRIC: ESX-1 secreted protein regulator EspR
- TUBERCULIST: ESX-1 transcriptional regulatory protein EspR
- NCBI: ESX-1 transcriptional regulatory protein EspR
- updated information (H37Rv4):
  - gene name: espR
  - function: regulator of ESX-1
  - reference: Blasco et al (2012) PMID: 22479184
Type: Not Target
Start: 4323499
End: 4323897
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- GO:0052572 - response to host immune response (Uniprot)
- GO:0050708 - regulation of protein secretion (Uniprot)
- GO:0043565 - sequence-specific DNA binding (Uniprot)
- GO:0042802 - identical protein binding (Uniprot)
- GO:0032993 - protein-DNA complex (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0009295 - nucleoid (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3qyx, 3qwg, 3qf3, 3r1f
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
4NDW	100%	Mycobacterium tuberculosis	Crystal STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS ESX-1 SECRETED PROTEIN REGULATOR (EspR)
3R1F	100%	Mycobacterium tuberculosis	Crystal structure of a key regulator of virulence in Mycobacterium tuberculosis
3QYX	100%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis EspR in complex with a small DNA fragment
3QWG	100%	Mycobacterium tuberculosis	Crystal structure of EspRdelta10, C-terminal 10 amino acids deletion mutant of EspR transcription factor from Mycobacterium tuberculosis
3QF3	100%	Mycobacterium tuberculosis	Crystal structure of EspR transcription factor from mycobacterium tuberculosis

Links to additional information on espR:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.4 (from Jeremy Rock's lab)

Amino Acid Sequence

MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVR
RIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA

(Nucleotide sequence available on KEGG)

Additional Information

EspR (regulator of ESX-1)
Blasco et al (2012) http://www.plospathogens.org/article/info%3Adoi%2F10.1371%2Fjournal.ppat.1002621

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.042850; 7 non-insertions in a row out of 9 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999900; 9 non-insertions in a row out of 9 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 9 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 10 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 10 sites
Growth-Defect	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Growth-Defect	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.91
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv0010c (-) (Direct binding)
- Rv0025 (-) (Direct binding)
- Rv0033 (acpA) (Direct binding)
- Rv0139 (-) (Direct binding)
- Rv0172 (mce1D) (Direct binding)
- Rv0386 (-) (Direct binding)
- Rv0397 (-) (Direct binding)
- Rv0405 (pks6) (Direct binding)
- Rv0635 (hadA) (Direct binding)
- Rv0684 (fusA1) (Direct binding)
- Rv0717 (rpsN1) (Direct binding)
- Rv0873 (fadE10) (Direct binding)
- Rv1067c (PE_PGRS19) (Direct binding)
- Rv1089A (celA2a) (Direct binding)
- Rv1297 (rho) (Direct binding)
- Rv1306 (atpF) (Direct binding)
- Rv1356c (-) (Direct binding)
- Rv1364c (-) (Direct binding)
- Rv1402 (priA) (Direct binding)
- Rv1478 (-) (Direct binding)
- Rv1479 (moxR1) (Direct binding)
- Rv1490 (-) (Direct binding)
- Rv1497 (lipL) (Direct binding)
- Rv1541c (lprI) (Direct binding)
- Rv1762c (-) (Direct binding)
- Rv1810 (-) (Direct binding)
- Rv1811 (mgtC) (Direct binding)
- Rv1816 (-) (Direct binding)
- Rv1824 (-) (Direct binding)
- Rv2143 (-) (Direct binding)
- Rv2145c (wag31) (Direct binding)
- Rv2237 (-) (Direct binding)
- Rv2307A (-) (Direct binding)
- Rv2307D (-) (Direct binding)
- Rv2560 (-) (Direct binding)
- Rv2665 (-) (Direct binding)
- Rv2783c (gpsI) (Direct binding)
- Rv2929 (-) (Direct binding)
- Rv2938 (drrC) (Direct binding)
- Rv2957 (-) (Direct binding)
- Rv3020c (esxS) (Direct binding)
- Rv3047c (-) (Direct binding)
- Rv3144c (PPE52) (Direct binding)
- Rv3239c (-) (Direct binding)
- Rv3343c (PPE54) (Direct binding)
- Rv3416 (whiB3) (Direct binding)
- Rv3463 (-) (Direct binding)
- Rv3488 (-) (Direct binding)
- Rv3614c (espD) (Direct binding)
- Rv3715c (recR) (Direct binding)
- Rv3781 (rfbE) (Direct binding)
- Rv3812 (PE_PGRS62) (Direct binding)
- Rv3890c (esxC) (Direct binding)
- Rv3917c (parB) (Direct binding)
- Rv3922c (-) (Direct binding)
- Rv0636 (hadB) (Upstream of operon)
- Rv0637 (hadC) (Upstream of operon)
- Rv1090 (celA2b) (Upstream of operon)
- Rv1353c (-) (Upstream of operon)
- Rv1354c (-) (Upstream of operon)
- Rv1355c (moeY) (Upstream of operon)
- Rv1480 (-) (Upstream of operon)
- Rv1481 (-) (Upstream of operon)
- Rv1761c (-) (Upstream of operon)
- Rv2144c (-) (Upstream of operon)
- Rv2782c (pepR) (Upstream of operon)
- Rv3019c (esxR) (Upstream of operon)
Bound By:
- Rv0081 (-) (Direct binding)
- Rv1033c (trcR) (Direct binding)
- Rv1049 (-) (Direct binding)
- Rv3681c (whiB4) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3849 (espR)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	PhysicalInteraction Rv3877	sourish10	IMP		Co-expression (Functional linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3877	sourish10	IMP		Co-expression (Functional linkage) A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008
Interaction	Transcription Rv3616c	shahanup86	IEP		Co-expression (Functional linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	Transcription Rv3615c	shahanup86	IEP		Co-expression (Functional linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	Transcription Rv3614c	shahanup86	IEP		Co-expression (Functional linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	ESX/type VII secretion systems and their role in host-pathogen interaction. authors,R. Simeone,D. Bottai,R. Brosch Curr. Opin. Microbiol. 2009	shahanup86	IEP	19155186	Co-expression (Functional linkage)
Interaction	Transcription Rv3616c	shahanup86	IEP		Co-expression (Functional linkage) authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009
Interaction	Transcription Rv3615c	shahanup86	IEP		Co-expression (Functional linkage) authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009
Interaction	Transcription Rv3614c	shahanup86	IEP		Co-expression (Functional linkage) authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	shahanup86	IEP	18685700	Co-expression (Functional linkage)
Interaction	PhysicalInteraction Rv3616c	darhngu	IMP		Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3616c	darhngu	IMP		Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	PhysicalInteraction Rv3615c	darhngu	IMP		Co-expression (Functional Linkage) B. Sidders, C. Pirson et al. Screening of highly expressed mycobacterial genes identifies Rv3615c as a useful differential diagnostic antigen for the Mycobacterium tuberculosis complex. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3615c	darhngu	IMP		Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3614c	darhngu	IMP		Co-expression (Functional Linkage) authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	PhysicalInteraction Rv3614c	darhngu	IMP		Co-expression (Functional Linkage) S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2008c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	Regulates Rv3616c	yamir.moreno	IDA		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0888	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1002c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1817	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3616c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3616c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IDA	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3614c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3615c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3615c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3613c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3614c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3612c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3612c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv3613c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Interaction	Regulates Rv1981c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
Interaction	Regulates Rv1981c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1854c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1982c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008
Citation	Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008	yamir.moreno	IEP	18685700	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.

Property

Value

Creator

Evidence

PMID

Comment

Interaction

PhysicalInteraction Rv3877

sourish10

IMP

Co-expression (Functional linkage)
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

PhysicalInteraction Rv3877

sourish10

IMP

Co-expression (Functional linkage)
A. Luthra, A. Mahmood et al. Characterization of Rv3868, an Essential Hypothetical Protein of the ESX-1 Secretion System in Mycobacterium tuberculosis. J. Biol. Chem. 2008

Interaction

Transcription Rv3616c

shahanup86

IEP

Co-expression (Functional linkage)
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

Transcription Rv3615c

shahanup86

IEP

Co-expression (Functional linkage)
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

Transcription Rv3614c

shahanup86

IEP

Co-expression (Functional linkage)
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

ESX/type VII secretion systems and their role in host-pathogen interaction. authors,R. Simeone,D. Bottai,R. Brosch Curr. Opin. Microbiol. 2009

shahanup86

IEP

19155186

Co-expression (Functional linkage)

Interaction

Transcription Rv3616c

shahanup86

IEP

Co-expression (Functional linkage)
authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009

Interaction

Transcription Rv3615c

shahanup86

IEP

Co-expression (Functional linkage)
authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009

Interaction

Transcription Rv3614c

shahanup86

IEP

Co-expression (Functional linkage)
authors,R. Simeone,D. Bottai,R. Brosch ESX/type VII secretion systems and their role in host-pathogen interaction. Curr. Opin. Microbiol. 2009

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

shahanup86

IEP

18685700

Co-expression (Functional linkage)

Interaction

PhysicalInteraction Rv3616c

darhngu

IMP

Co-expression (Functional Linkage)
authors,SM. Fortune,A. Jaeger,DA. Sarracino,MR. Chase,CM. Sassetti,DR. Sherman,BR. Bloom,EJ. Rubin Mutually dependent secretion of proteins required for mycobacterial virulence. Proc. Natl. Acad. Sci. U.S.A. 2005

Interaction

PhysicalInteraction Rv3616c

darhngu

IMP

Co-expression (Functional Linkage)
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

PhysicalInteraction Rv3615c

darhngu

IMP

Co-expression (Functional Linkage)
B. Sidders, C. Pirson et al. Screening of highly expressed mycobacterial genes identifies Rv3615c as a useful differential diagnostic antigen for the Mycobacterium tuberculosis complex. Infect. Immun. 2008

Interaction

PhysicalInteraction Rv3615c

darhngu

IMP

Interaction

PhysicalInteraction Rv3614c

darhngu

IMP

Interaction

PhysicalInteraction Rv3614c

darhngu

IMP

Co-expression (Functional Linkage)
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

RegulatedBy Rv0757

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv2008c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

Regulates Rv3616c

yamir.moreno

IDA

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv0888

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv1002c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv1817

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3616c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3616c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IDA

18685700

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3614c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3615c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3615c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3613c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3614c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3612c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3612c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv3613c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Interaction

Regulates Rv1981c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv1981c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv1854c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Interaction

Regulates Rv1982c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raghavan, P. Manzanillo et al. Secreted transcription factor controls Mycobacterium tuberculosis virulence. Nature 2008

Citation

Secreted transcription factor controls Mycobacterium tuberculosis virulence. S. Raghavan, P. Manzanillo et al. Nature 2008

yamir.moreno

IEP

18685700

Comments