Rv3820c (papA2)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: acyltransferase papA2
- REFSEQ: polyketide synthase associated protein PapA2
- PATRIC: Polyketide synthase associated protein papA2
- TUBERCULIST: Possible conserved polyketide synthase associated protein PapA2
- NCBI: Possible conserved polyketide synthase associated protein PapA2
- updated information (H37Rv4):
  - gene name: papA2
  - function: sulfolipid-1 synthesis
  - reference: Seeliger (2012) PMID: 22194604
Type: Not Target
Start: 4284419
End: 4285825
Operon:

Trans-membrane region:
Role: I.I - Polyketide and non-ribosomal peptide synthesis
GO terms:
- GO:0046506 - sulfolipid biosynthetic process (Uniprot)
- GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups (Uniprot)
- GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

6AEF 100% Mycobacterium tuberculosis CAS/NITR204 PapA2 acyl transferase
Links to additional information on papA2:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.07 (from Jeremy Rock's lab)
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
6AEF	100%	Mycobacterium tuberculosis CAS/NITR204	PapA2 acyl transferase

Amino Acid Sequence

VFSITTLRDWTPDPGSIICWHASPTAKAKARQAPISEVPPSYQQAQHLRRYRDHVARGLDMSRLMIFTWDLPGRCNIRAMNYAINAHLRRHDTYHSWFEF
DNAEHIVRHTIADPADIEVVQAEHQNMTSAELRHHIATPQPLQWDCFLFGIIQSDDHFTFYASIAHLCVDPMIVGVLFIEIHMMYSALVGGDPPIELPPA
GRYDDHCVRQYADTAALTLDSARVRRWVEFAANNDGTLPHFPLPLGDLSVPHTGKLLTETLMDEQQGERFEAACVAAGARFSGGVFACAALAERELTNCE
TFDVVTTTDTRRTPTELRTTGWFTGLVPITVPVASGLFDSAARVAQISFDSGKDLATVPFDRVLELARPETGLRPPRPGNFVMSFLDASIAPLSTVANSD
LNFRIYDEGRVSHQVSMWVNRYQHQTTVTVLFPDNPIASESVANYIAAMKSIYIRTADGTLATLKPGT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.987600; 14 non-insertions in a row out of 44 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 8 non-insertions in a row out of 44 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 8 non-insertions in a row out of 44 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000100; 8 non-insertions in a row out of 44 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.973550; 11 non-insertions in a row out of 44 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.43
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Name	Acyltransferase responsible for the palmitoylation of trehalose-2-sulfate at the 2'-position (using palmitoyl-CoA) to form trehalose-2-sulfate-2'-palmitate	mjackson	IMP		Polymethyl-branched acyltrehaloses
Name	Acyltransferase responsible for the palmitoylation of trehalose-2-sulfate at the 2'-position (using palmitoyl-CoA) to form trehalose-2-sulfate-2'-palmitate	mjackson	IDA		Polymethyl-branched acyltrehaloses
Citation	PapA1 and PapA2 are acyltransferases essential for the biosynthesis of the Mycobacterium tuberculosis virulence factor sulfolipid-1. P. Kumar, MW. Schelle et al. Proc. Natl. Acad. Sci. U.S.A. 2007	mjackson		17592143	Acyltransferase responsible for the palmitoylation of trehalose-2-sulfate at the 2'-position (using palmitoyl-CoA) to form trehalose-2-sulfate-2'-palmitate (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:Polymethyl-branched acyltrehaloses	mjackson			Acyltransferase responsible for the palmitoylation of trehalose-2-sulfate at the 2'-position (using palmitoyl-CoA) to form trehalose-2-sulfate-2'-palmitate (phenotypic [mycobacterial recombinant strains]; enzymatic) P. Kumar, MW. Schelle et al. PapA1 and PapA2 are acyltransferases essential for the biosynthesis of the Mycobacterium tuberculosis virulence factor sulfolipid-1. Proc. Natl. Acad. Sci. U.S.A. 2007

TB Genome Annotation Portal