Rv3808c (glfT2)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: UDP-galactofuranosyl transferase GlfT2
- REFSEQ: bifunctional UDP-galactofuranosyl transferase GLFT
- PATRIC: Galactofuranosyl transferase (EC 2.-.-.-)
- TUBERCULIST: Bifunctional UDP-galactofuranosyl transferase GlfT2
- NCBI: Bifunctional UDP-galactofuranosyl transferase GlfT2
- updated information (H37Rv4):
  - gene name: glfT2
  - function:
  - reference:
Type: Not Target
Start: 4270366
End: 4272279
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- GO:0071769 - mycolate cell wall layer assembly (Uniprot)
- GO:0071555 - cell wall organization (Uniprot)
- GO:0070592 - cell wall polysaccharide biosynthetic process (Uniprot)
- GO:0052573 - UDP-D-galactose metabolic process (Uniprot)
- GO:0046872 - metal ion binding (Uniprot)
- GO:0045227 - capsule polysaccharide biosynthetic process (Uniprot)
- GO:0044038 - cell wall macromolecule biosynthetic process (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0035496 - lipopolysaccharide-1,5-galactosyltransferase activity (Uniprot)
- GO:0035250 - UDP-galactosyltransferase activity (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0009103 - lipopolysaccharide biosynthetic process (Uniprot)
- GO:0008921 - lipopolysaccharide-1,6-galactosyltransferase activity (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- RHAMNAGDPP[c] + 30 UDPGALF[c] <=> 30 UDP[c] + GALACTANDPP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 4fix, 4fiy
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

4FIY 100% Mycobacterium tuberculosis Crystal Structure of GlfT2 Complexed with UDP

4FIX 100% Mycobacterium tuberculosis Crystal Structure of GlfT2
Links to additional information on glfT2:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -12.751 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
4FIY	100%	Mycobacterium tuberculosis	Crystal Structure of GlfT2 Complexed with UDP
4FIX	100%	Mycobacterium tuberculosis	Crystal Structure of GlfT2

Amino Acid Sequence

MSELAASLLSRVILPRPGEPLDVRKLYLEESTTNARRAHAPTRTSLQIGAESEVSFATYFNAFPASYWRRWTTCKSVVLRVQVTGAGRVDVYRTKATGAR
IFVEGHDFTGTEDQPAAVETEVVLQPFEDGGWVWFDITTDTAVTLHSGGWYATSPAPGTANIAVGIPTFNRPADCVNALRELTADPLVDQVIGAVIVPDQ
GERKVRDHPDFPAAAARLGSRLSIHDQPNLGGSGGYSRVMYEALKNTDCQQILFMDDDIRLEPDSILRVLAMHRFAKAPMLVGGQMLNLQEPSHLHIMGE
VVDRSIFMWTAAPHAEYDHDFAEYPLNDNNSRSKLLHRRIDVDYNGWWTCMIPRQVAEELGQPLPLFIKWDDADYGLRAAEHGYPTVTLPGAAIWHMAWS
DKDDAIDWQAYFHLRNRLVVAAMHWDGPKAQVIGLVRSHLKATLKHLACLEYSTVAIQNKAIDDFLAGPEHIFSILESALPQVHRIRKSYPDAVVLPAAS
ELPPPLHKNKAMKPPVNPLVIGYRLARGIMHNLTAANPQHHRRPEFNVPTQDARWFLLCTVDGATVTTADGCGVVYRQRDRAKMFALLWQSLRRQRQLLK
RFEEMRRIYRDALPTLSSKQKWETALLPAANQEPEHG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 29 non-insertions in a row out of 29 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 29 non-insertions in a row out of 29 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 29 non-insertions in a row out of 29 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 29 non-insertions in a row out of 29 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 29 non-insertions in a row out of 29 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.03
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3574 (kstR) (Upstream of operon)
- Rv3736 (-) (Upstream of operon)
- Rv3830c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3808c (glfT2)

Property	Value	Creator	Evidence	PMID	Comment
Term	TBRXN:GALFT galactofuranose transferse (M tb) - ISS	njamshidi	ISS	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	njamshidi	IDA	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
Term	TBRXN:GALFT galactofuranose transferse (M tb) - IDA	njamshidi	IDA	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001	njamshidi	IDA	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
Term	TBRXN:GALFT galactofuranose transferse (M tb) - IDA	njamshidi	IDA	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Citation	Biosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000	njamshidi	IDA	11555614\|10934214\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
Term	TBRXN:GALFT galactofuranose transferse (M tb) - IDA	njamshidi	IDA	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	njamshidi	ISS	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
Term	TBRXN:GALFT galactofuranose transferse (M tb) - ISS	njamshidi	ISS	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001	njamshidi	ISS	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
Term	TBRXN:GALFT galactofuranose transferse (M tb) - ISS	njamshidi	ISS	10934214\|11555614\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Citation	Biosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000	njamshidi	ISS	11555614\|10934214\|11304545	See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
Symbol	glfT2	mjackson	IDA		Galactosyltransferases
Name	Bifucntional galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid	mjackson	IDA		Galactosyltransferases
Term	GO:0008378 galactosyltransferase activity - NR	mmcneil	NR		Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Symbol	glfT2	mmcneil			Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid F. Pan, M. Jackson et al. Cell wall core galactofuran synthesis is essential for growth of mycobacteria. J. Bacteriol. 2001
Citation	Cell wall core galactofuran synthesis is essential for growth of mycobacteria. F. Pan, M. Jackson et al. J. Bacteriol. 2001	mmcneil		11395463	Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid
Term	GO:0008378 galactosyltransferase activity - NR	mmcneil	NR		Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid F. Pan, M. Jackson et al. Cell wall core galactofuran synthesis is essential for growth of mycobacteria. J. Bacteriol. 2001
Symbol	glfT2	mmcneil			Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Citation	Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001	mmcneil		11304545	Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	jjmcfadden		11555614	Inferred from direct assay
Term	EC:2.-.-.- Transferases. - NR	jjmcfadden	NR		Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	extern:JZUCKER		11555614	Inferred from direct assay
Term	EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR	extern:JZUCKER	NR		Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Term	EC:2.4.1.205 Galactogen 6-beta-galactosyltransferase. - NR	extern:JZUCKER	NR		Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Term	EC:2.-.-.- Transferases. - NR	extern:JZUCKER	NR		Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001	extern:JZUCKER		11304545	Assay of protein purified to homogeneity from a heterlogous host
Term	EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Term	EC:2.4.1.205 Galactogen 6-beta-galactosyltransferase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Term	EC:2.-.-.- Transferases. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Term	EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR	extern:JZUCKER	NR		Assay of protein partially-purified from a heterlogous host L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001
Citation	Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001	extern:JZUCKER		11304545	Assay of protein partially-purified from a heterlogous host

Property

Value

Creator

Evidence

PMID

Comment

Term

TBRXN:GALFT galactofuranose transferse (M tb) - ISS

njamshidi

ISS

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

njamshidi

IDA

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology

Term

TBRXN:GALFT galactofuranose transferse (M tb) - IDA

njamshidi

IDA

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Citation

Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001

njamshidi

IDA

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology

Term

TBRXN:GALFT galactofuranose transferse (M tb) - IDA

njamshidi

IDA

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology
L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001

Citation

Biosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000

njamshidi

IDA

11555614|10934214|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology

Term

TBRXN:GALFT galactofuranose transferse (M tb) - IDA

njamshidi

IDA

10934214|11555614|11304545

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

njamshidi

ISS

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology

Term

TBRXN:GALFT galactofuranose transferse (M tb) - ISS

njamshidi

ISS

10934214|11555614|11304545

Citation

Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001

njamshidi

ISS

10934214|11555614|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology

Term

TBRXN:GALFT galactofuranose transferse (M tb) - ISS

njamshidi

ISS

10934214|11555614|11304545

Citation

Biosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000

njamshidi

ISS

11555614|10934214|11304545

See PMID: 11555614, 11304545, 10934214 - total number of Galf added for Mtb believed to be between 30 and 50, added 30 for current model version as per Crick et al 2001 Glycobiology

Symbol

glfT2

mjackson

IDA

Galactosyltransferases

Name

Bifucntional galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid

mjackson

IDA

Galactosyltransferases

Term

GO:0008378 galactosyltransferase activity - NR

mmcneil

Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid
L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001

Symbol

glfT2

mmcneil

Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid
F. Pan, M. Jackson et al. Cell wall core galactofuran synthesis is essential for growth of mycobacteria. J. Bacteriol. 2001

Citation

Cell wall core galactofuran synthesis is essential for growth of mycobacteria. F. Pan, M. Jackson et al. J. Bacteriol. 2001

mmcneil

11395463

Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid

Term

GO:0008378 galactosyltransferase activity - NR

mmcneil

Symbol

glfT2

mmcneil

Citation

Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001

mmcneil

11304545

Bifunctional Galactofuranosyl transferase which elongate the galactan of approximately 24 residues from Gal-Gal-Rha-GlcNAc-P-P-decaprenyl carrier lipid

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

jjmcfadden

11555614

Inferred from direct assay

Term

EC:2.-.-.- Transferases. - NR

jjmcfadden

Inferred from direct assay
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

extern:JZUCKER

11555614

Inferred from direct assay

Term

EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR

extern:JZUCKER

Inferred from direct assay
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Term

EC:2.4.1.205 Galactogen 6-beta-galactosyltransferase. - NR

extern:JZUCKER

Inferred from direct assay
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Term

EC:2.-.-.- Transferases. - NR

extern:JZUCKER

Inferred from direct assay
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Citation

Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001

extern:JZUCKER

11304545

Assay of protein purified to homogeneity from a heterlogous host

Term

EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR

extern:JZUCKER

Assay of protein purified to homogeneity from a heterlogous host
L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001

Term

EC:2.4.1.205 Galactogen 6-beta-galactosyltransferase. - NR

extern:JZUCKER

Term

EC:2.-.-.- Transferases. - NR

extern:JZUCKER

Term

EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR

extern:JZUCKER

Assay of protein partially-purified from a heterlogous host
L. Kremer, LG. Dover et al. Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. J. Biol. Chem. 2001

Citation

Galactan biosynthesis in Mycobacterium tuberculosis. Identification of a bifunctional UDP-galactofuranosyltransferase. L. Kremer, LG. Dover et al. J. Biol. Chem. 2001

extern:JZUCKER

11304545

Assay of protein partially-purified from a heterlogous host

Comments