TB Genome Annotation Portal

Rv3808c (glfT2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: UDP-galactofuranosyl transferase GlfT2
  • REFSEQ: bifunctional UDP-galactofuranosyl transferase GLFT
  • PATRIC: Galactofuranosyl transferase (EC 2.-.-.-)
  • TUBERCULIST: Bifunctional UDP-galactofuranosyl transferase GlfT2
  • NCBI: Bifunctional UDP-galactofuranosyl transferase GlfT2
  • updated information (H37Rv4):
    • gene name: glfT2
    • function:
    • reference:
• Type: Not Target
• Start: 4270366
• End: 4272279
• Operon:


• Trans-membrane region:
  
• Role: VI - Unknowns
• GO terms:
  • GO:0071769 - mycolate cell wall layer assembly (Uniprot)
  • GO:0071555 - cell wall organization (Uniprot)
  • GO:0070592 - cell wall polysaccharide biosynthetic process (Uniprot)
  • GO:0052573 - UDP-D-galactose metabolic process (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0045227 - capsule polysaccharide biosynthetic process (Uniprot)
  • GO:0044038 - cell wall macromolecule biosynthetic process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0035496 - lipopolysaccharide-1,5-galactosyltransferase activity (Uniprot)
  • GO:0035250 - UDP-galactosyltransferase activity (Uniprot)
  • GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0009103 - lipopolysaccharide biosynthetic process (Uniprot)
  • GO:0008921 - lipopolysaccharide-1,6-galactosyltransferase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • RHAMNAGDPP[c] + 30 UDPGALF[c] <=> 30 UDP[c] + GALACTANDPP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 4fix, 4fiy
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4FIY	100%	Mycobacterium tuberculosis	Crystal Structure of GlfT2 Complexed with UDP
  4FIX	100%	Mycobacterium tuberculosis	Crystal Structure of GlfT2

• Links to additional information on glfT2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -12.751 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSELAASLLSRVILPRPGEPLDVRKLYLEESTTNARRAHAPTRTSLQIGAESEVSFATYFNAFPASYWRRWTTCKSVVLRVQVTGAGRVDVYRTKATGAR
IFVEGHDFTGTEDQPAAVETEVVLQPFEDGGWVWFDITTDTAVTLHSGGWYATSPAPGTANIAVGIPTFNRPADCVNALRELTADPLVDQVIGAVIVPDQ
GERKVRDHPDFPAAAARLGSRLSIHDQPNLGGSGGYSRVMYEALKNTDCQQILFMDDDIRLEPDSILRVLAMHRFAKAPMLVGGQMLNLQEPSHLHIMGE
VVDRSIFMWTAAPHAEYDHDFAEYPLNDNNSRSKLLHRRIDVDYNGWWTCMIPRQVAEELGQPLPLFIKWDDADYGLRAAEHGYPTVTLPGAAIWHMAWS
DKDDAIDWQAYFHLRNRLVVAAMHWDGPKAQVIGLVRSHLKATLKHLACLEYSTVAIQNKAIDDFLAGPEHIFSILESALPQVHRIRKSYPDAVVLPAAS
ELPPPLHKNKAMKPPVNPLVIGYRLARGIMHNLTAANPQHHRRPEFNVPTQDARWFLLCTVDGATVTTADGCGVVYRQRDRAKMFALLWQSLRRQRQLLK
RFEEMRRIYRDALPTLSSKQKWETALLPAANQEPEHG

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.79 (0.36)	1.21 (0.49)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link