Rv3805c (aftB)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: arabinofuranosyltrasnferase
- REFSEQ: transmembrane protein
- PATRIC: hypothetical protein Rv3805c
- TUBERCULIST: Possible arabinofuranosyltransferase AftB
- NCBI: Possible arabinofuranosyltransferase AftB
- updated information (H37Rv4):
  - gene name: aftB
  - function:
  - reference:
Type: Essential
Start: 4266953
End: 4268836
Operon:

Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
- GO:0071555 - cell wall organization (Uniprot)
- GO:0045227 - capsule polysaccharide biosynthetic process (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on aftB:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -4.217 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MVRVSLWLSVTAVAVLFGWGSWQRRWIADDGLIVLRTVRNLLAGNGPVFNQGERVEANTSTAWTYLLYVGGWVGGPMRLEYVALALAMVLSLLGMVLLML
GTGRLYAPSLRGRRAIMLPAGALVYIAVPPARDFATSGLESGLVLAYLGLLWWMMVCWSQPLRARPDSQMFLGALAFVAGCSVLVRPEFALIGGLALIMM
LIAARTWRRRVLIVLAGGFLPVAYQIFRMGYYGLLVPSTALAKDAAGDKWSQGMIYVSNFNRPYALWVPLVLSVPLGLLLMTARRRPSFLRPVLAPDYGR
VARAVQSPPAVVAFIVGSGVLQALYWIRQGGDFMHGRVLLAPLFCLLAPVGVIPILLPDGKDFSRETGRWLVGALSGLWLGIAGWSLWAANSPGMGDDAT
RVTYSGIVDERRFYAQATGHAHPLTAADYLDYPRMAAVLTALNNTPEGALLLPSGNYNQWDLVPMIRPSSGTAPGGKPAPKPQHAVFFTNMGMLGMNVGL
DVRVIDQIGLVNPLAAHTERLKHARIGHDKNLFPDWVIADGPWVKWYPGIPGYIDQQWVTQAEAALQCPATRAVLNSVRAPITLHRFLSNVLHSYEFTRY
RIDRVPRYELVRCGLDVPDGPGPPPRE

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 39 non-insertions in a row out of 40 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.09
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0967 (csoR) (Direct binding)
- Rv1353c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Identification of a novel arabinofuranosyltransferase AftB involved in a terminal step of cell wall arabinan biosynthesis in Corynebacterianeae, such as Corynebacterium glutamicum and Mycobacterium tuberculosis. M. Seidel, LJ. Alderwick et al. J. Biol. Chem. 2007	sourish10	ISO	17387176	Co-occurrence (Functional linkage)
Interaction	Transcription Rv3806c	sourish10	ISO		Co-occurrence (Functional linkage) M. Seidel, LJ. Alderwick et al. Identification of a novel arabinofuranosyltransferase AftB involved in a terminal step of cell wall arabinan biosynthesis in Corynebacterianeae, such as Corynebacterium glutamicum and Mycobacterium tuberculosis. J. Biol. Chem. 2007
Symbol	aftB	mjackson	IMP		Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase which transfers the terminal beta arabinosyl unit to the 2 position of an arabinosyl residue	mjackson	IMP		Arabinosyltransferases
Symbol	aftB	mjackson	IDA		Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase which transfers the terminal beta arabinosyl unit to the 2 position of an arabinosyl residue	mjackson	IDA		Arabinosyltransferases
Symbol	aftB	mmcneil			Decaprenol phosphoarabinose-dependent arabinosyltransferase which transferase the terminal beta arabinosyl unit to the 2 position of an arabinosyl residue M. Seidel, LJ. Alderwick et al. Identification of a novel arabinofuranosyltransferase AftB involved in a terminal step of cell wall arabinan biosynthesis in Corynebacterianeae, such as Corynebacterium glutamicum and Mycobacterium tuberculosis. J. Biol. Chem. 2007
Citation	Identification of a novel arabinofuranosyltransferase AftB involved in a terminal step of cell wall arabinan biosynthesis in Corynebacterianeae, such as Corynebacterium glutamicum and Mycobacterium tuberculosis. M. Seidel, LJ. Alderwick et al. J. Biol. Chem. 2007	mmcneil		17387176	Decaprenol phosphoarabinose-dependent arabinosyltransferase which transferase the terminal beta arabinosyl unit to the 2 position of an arabinosyl residue
Term	GO:0052636 arabinosyltransferase activity - NR	mmcneil	NR		Decaprenol phosphoarabinose-dependent arabinosyltransferase which transferase the terminal beta arabinosyl unit to the 2 position of an arabinosyl residue M. Seidel, LJ. Alderwick et al. Identification of a novel arabinofuranosyltransferase AftB involved in a terminal step of cell wall arabinan biosynthesis in Corynebacterianeae, such as Corynebacterium glutamicum and Mycobacterium tuberculosis. J. Biol. Chem. 2007

TB Genome Annotation Portal