TB Genome Annotation Portal

Rv3799c (accD4)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: propionyl-CoA carboxylase beta chain
  • REFSEQ: propionyl-CoA carboxylase beta chain
  • PATRIC: Propionyl-CoA carboxylase beta chain (EC 6.4.1.3)
  • TUBERCULIST: Probable propionyl-CoA carboxylase beta chain 4 AccD4 (pccase) (propanoyl-CoA:carbon dioxide ligase)
  • NCBI: Probable propionyl-CoA carboxylase beta chain 4 AccD4 (pccase) (propanoyl-CoA:carbon dioxide ligase)
  • updated information (H37Rv4):
    • gene name: accD4
    • function:
    • reference:
• Type: Essential
• Start: 4254380
• End: 4255948
• Operon:


• Trans-membrane region:
  
• Role: I.H.1 - Synthesis of fatty and mycolic acids
• GO terms:
  • GO:0071769 - mycolate cell wall layer assembly (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0016421 - CoA carboxylase activity (Uniprot)
  • GO:0015977 - carbon fixation (Uniprot)
  • GO:0009317 - acetyl-CoA carboxylase complex (Uniprot)
  • GO:0009062 - fatty acid catabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004658 - propionyl-CoA carboxylase activity (Uniprot)
  • GO:0003989 - acetyl-CoA carboxylase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • PROPIONYLCOA[c] + BIOTIN_CO2[c] -> SMMALONYLCOA[c] + 0.999 BIOTIN[c]
  • BIOTIN_CO2[c] + 3MBECOA[c] -> 0.999 BIOTIN[c] + MGLUTCOA[c]
  • ACCOA[c] + BIOTIN_CO2[c] -> 0.999 BIOTIN[c] + MALCOA[c]
  • BIOTIN_CO2[c] + HEXACOSANOYL_COA[c] -> BIOTIN[c] + HEXACOSANOYL_COA_CO2[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3IBB	49%	Streptomyces coelicolor	Propionyl-CoA Carboxylase Beta Subunit, D422A
  3MFM	49%	Streptomyces coelicolor	Crystal Structures and Mutational Analyses of Acyl-CoA Carboxylase Subunit of Streptomyces coelicolor
  3IB9	49%	Streptomyces coelicolor	Propionyl-CoA Carboxylase Beta Subunit, D422L
  3IAV	49%	Streptomyces coelicolor	Propionyl-CoA Carboxylase Beta Subunit, D422V
  1XO6	49%	Streptomyces coelicolor	Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #3
  1XNY	49%	Streptomyces coelicolor	Biotin and propionyl-CoA bound to Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB)
  1XNW	49%	Streptomyces coelicolor	Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #2, mutant D422I
  1XNV	49%	Streptomyces coelicolor	Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #1
  5INI	48%	Streptomyces ambofaciens ATCC 23877	Structural basis for acyl-CoA carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics
  5ING	48%	Streptomyces ambofaciens ATCC 23877	A crotonyl-CoA reductase-carboxylase independent pathway for assembly of unusual alkylmalonyl-CoA polyketide synthase extender unit

• Links to additional information on accD4:
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -9.268 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VTVTEPVLHTTAEKLAELRERLELAKEPGGEKAAAKRDKKGIPSARARIYELVDPGSFMEIGALCRTPGDPNALYGDGVVTGHGLINGRPVGVFSHDQTV
FGGTVGEMFGRKVARLMEWCAMVGCPIVGINDSGGARIQDAVTSLAWYAELGRRHELLSGLVPQISIILGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGP
DVIKDVTGEDVSLDELGGADHQASYGNIHQVVESEAAAYQYVRDFLSFLPSNCFDKPPVVNPGLEPEITGHDLELDSIVPDSDNMAYDMHEVLLRIFDDG
DFLDVAAQAGQAIITGYARVDGRTVGVVANQPMHMSGAIDNEASDKAARFIRFSDAFDIPLVFVVDTPGFLPGVEQEKNGIIKRGGRFLYAVVEADVPKV
TITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGADGAAQLLMKRFPDPNAPEAQAIRKSFVENYNLNMAIPWIAAERGFIDAVIDPHETRLLLRKS
MHLLRDKQLWWRVGRKHGLIPV

Additional Information