Rv3795 (embB)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: arabinosyltransferase B
- REFSEQ: integral membrane indolylacetylinositol arabinosyltransferase EMBB (arabinosylindolylacetylinositol synthase)
- PATRIC: INTEGRAL MEMBRANE INDOLYLACETYLINOSITOL ARABINOSYLTRANSFERASE EMBC (ARABINOSYLINDOLYLACETYLINOSITOL SYNTHASE)
- TUBERCULIST: Integral membrane indolylacetylinositol arabinosyltransferase EmbB (arabinosylindolylacetylinositol synthase)
- NCBI: Integral membrane indolylacetylinositol arabinosyltransferase EmbB (arabinosylindolylacetylinositol synthase)
- updated information (H37Rv4):
  - gene name: embB
  - function:
  - reference:
Type: Not Target
Start: 4246514
End: 4249810
Operon:

Trans-membrane region:
Role: II.C.2 - Surface polysaccharides, lipopolysaccharides, proteins and antigens
GO terms:
- GO:0071766 - Actinobacterium-type cell wall biogenesis (Uniprot)
- GO:0071555 - cell wall organization (Uniprot)
- GO:0052636 - arabinosyltransferase activity (Uniprot)
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 70 ARAFDPP[c] + ARA_91_1_93_GALACTANDPP[c] <=> 70 DPP[c] + ARABINOGALACTANDPP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
7BVF	100%	Mycobacterium tuberculosis H37Rv	Cryo-EM structure of Mycobacterium tuberculosis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol
7BX8	68%	Mycolicibacterium smegmatis MC2 155	Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in symmetric "resting state"
7BWR	68%	Mycolicibacterium smegmatis MC2 155	Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in substrate DPA bound asymmetric "active state"
7BVG	68%	Mycolicibacterium smegmatis MC2 155	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose.
7BVC	68%	Mycolicibacterium smegmatis MC2 155	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol
6X0O	68%	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)	Single-Particle Cryo-EM Structure of Arabinosyltransferase EmbB from Mycobacterium smegmatis
7BVH	44%	Mycolicibacterium smegmatis MC2 155	Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose
7BVE	44%	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbC2-AcpM2 in complex with ethambutol
3PTY	42%	Mycobacterium tuberculosis	Crystal structure of the C-terminal extracellular domain of Mycobacterium tuberculosis EmbC
7BVF	42%	Mycobacterium tuberculosis H37Rv	Cryo-EM structure of Mycobacterium tuberculosis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol

Links to additional information on embB:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -5.845 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- Photo of spot titer

Amino Acid Sequence

MTQCASRRKSTPNRAILGAFASARGTRWVATIAGLIGFVLSVATPLLPVVQTTAMLDWPQRGQLGSVTAPLISLTPVDFTATVPCDVVRAMPPAGGVVLG
TAPKQGKDANLQALFVVVSAQRVDVTDRNVVILSVPREQVTSPQCQRIEVTSTHAGTFANFVGLKDPSGAPLRSGFPDPNLRPQIVGVFTDLTGPAPPGL
AVSATIDTRFSTRPTTLKLLAIIGAIVATVVALIALWRLDQLDGRGSIAQLLLRPFRPASSPGGMRRLIPASWRTFTLTDAVVIFGFLLWHVIGANSSDD
GYILGMARVADHAGYMSNYFRWFGSPEDPFGWYYNLLALMTHVSDASLWMRLPDLAAGLVCWLLLSREVLPRLGPAVEASKPAYWAAAMVLLTAWMPFNN
GLRPEGIIALGSLVTYVLIERSMRYSRLTPAALAVVTAAFTLGVQPTGLIAVAALVAGGRPMLRILVRRHRLVGTLPLVSPMLAAGTVILTVVFADQTLS
TVLEATRVRAKIGPSQAWYTENLRYYYLILPTVDGSLSRRFGFLITALCLFTAVFIMLRRKRIPSVARGPAWRLMGVIFGTMFFLMFTPTKWVHHFGLFA
AVGAAMAALTTVLVSPSVLRWSRNRMAFLAALFFLLALCWATTNGWWYVSSYGVPFNSAMPKIDGITVSTIFFALFAIAAGYAAWLHFAPRGAGEGRLIR
ALTTAPVPIVAGFMAAVFVASMVAGIVRQYPTYSNGWSNVRAFVGGCGLADDVLVEPDTNAGFMKPLDGDSGSWGPLGPLGGVNPVGFTPNGVPEHTVAE
AIVMKPNQPGTDYDWDAPTKLTSPGINGSTVPLPYGLDPARVPLAGTYTTGAQQQSTLVSAWYLLPKPDDGHPLVVVTAAGKIAGNSVLHGYTPGQTVVL
EYAMPGPGALVPAGRMVPDDLYGEQPKAWRNLRFARAKMPADAVAVRVVAEDLSLTPEDWIAVTPPRVPDLRSLQEYVGSTQPVLLDWAVGLAFPCQQPM
LHANGIAEIPKFRITPDYSAKKLDTDTWEDGTNGGLLGITDLLLRAHVMATYLSRDWARDWGSLRKFDTLVDAPPAQLELGTATRSGLWSPGKIRIGP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 49 non-insertions in a row out of 49 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 49 non-insertions in a row out of 49 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 49 non-insertions in a row out of 49 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 49 non-insertions in a row out of 50 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 49 non-insertions in a row out of 50 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.06
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)
- Rv3416 (whiB3)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0135c (-) (Direct binding)
- Rv0967 (csoR) (Direct binding)
- Rv0302 (-) (Upstream of operon)
- Rv2324 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)
- Rv3416 (whiB3)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3795 (embB)

Property	Value	Creator	Evidence	PMID	Comment
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	njamshidi	IPI	9142129\|11555614	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
Citation	Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006	njamshidi	ISS	16595677\|9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	njamshidi	ISS	9142129\|11555614	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
Citation	Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006	njamshidi	IPI	16595677\|9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Citation	The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Interaction	Regulatory Rv1267c	ashwinigbhat	IEP		Co-expression (Functional linkage) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	ashwinigbhat	IEP	17956343	Co-expression (Functional linkage)
Interaction	Regulatory Rv1267c	ashwinigbhat	IEP		Co-expression (Functional linkage) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	ashwinigbhat	IEP	18174142	Co-expression (Functional linkage)
Interaction	Regulatory Rv1267c	ashwinigbhat	IEP		Co-expression (Functional linkage) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	ashwinigbhat	IDA	18174142	Structural Analysis
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	IDA		Structural Analysis AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	priti.priety	IEP	11677227	Co-expression (Functional linkage)
Interaction	Regulatory Rv1267c	priti.priety	IEP		Co-expression (Functional linkage) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	priti.priety	IEP	17956343	Co-expression (Functional linkage)
Interaction	Regulatory Rv1267c	priti.priety	IEP		Co-expression (Functional linkage) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	priti.priety	IEP	18174142	Co-expression (Functional linkage)
Interaction	Regulatory Rv1267c	priti.priety	IEP		Co-expression (Functional linkage) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	ashwinigbhat	IEP	11677227	Co-expression (Functional linkage)
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	IDA		Spectrophotometric VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	ashwinigbhat	IDA	17956343	Spectrophotometric
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	IDA		Spectrophotometric authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	ashwinigbhat	IDA	18174142	Spectrophotometric
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	IDA		Spectrophotometric AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	ashwinigbhat	IDA	11677227	Structural Analysis
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	IDA		Structural Analysis VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	ashwinigbhat	IDA	17956343	Structural Analysis
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	IDA		Structural Analysis authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	priti.priety	IDA	18174142	Spectrophotometric
Interaction	PhysicalInteraction Rv3794	priti.priety	IDA		Spectrophotometric AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	priti.priety	IDA	11677227	Structural Analysis
Interaction	PhysicalInteraction Rv3794	priti.priety	IDA		Structural Analysis VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	priti.priety	IDA	17956343	Structural Analysis
Interaction	PhysicalInteraction Rv3794	priti.priety	IDA		Structural Analysis authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	priti.priety	IDA	18174142	Structural Analysis
Interaction	PhysicalInteraction Rv3794	priti.priety	IDA		Structural Analysis AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	ashwinigbhat	IDA	11677227	Spectrophotometric
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	priti.priety	IDA	11677227	Spectrophotometric
Interaction	PhysicalInteraction Rv3794	priti.priety	IDA		Spectrophotometric VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	priti.priety	IDA	17956343	Spectrophotometric
Interaction	PhysicalInteraction Rv3794	priti.priety	IDA		Spectrophotometric authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	NAS		authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	NAS		AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3794	priti.priety	NAS		VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3794	priti.priety	NAS		authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3794	priti.priety	NAS		AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3794	ashwinigbhat	NAS		VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv1266c	shahanup86	NAS		Affinity purification (Physical interaction) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv1267c	priyadarshinipriyanka2001	IDA		Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	yamir.moreno	IEP		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	yamir.moreno	IDA		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; also proposed to elongate arabinan, probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA; inhibition by ethambutol	mjackson	IMP		Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; also proposed to elongate arabinan, probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA; inhibition by ethambutol	mjackson	IDA		Arabinosyltransferases
Citation	The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996	mmcneil		8876238	Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA inhibition by ethambutol
Term	GO:0052636 arabinosyltransferase activity - NR	mmcneil	NR		Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA inhibition by ethambutol AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996
Citation	Sulfate as a synergistic anion facilitating iron binding by the bacterial transferrin FbpA: the origins and effects of anion promiscuity. authors,JJ. Heymann,KD. Weaver,TA. Mietzner,AL. Crumbliss J. Am. Chem. Soc. 2007	mmcneil		17630737	Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA inhibition by ethambutol
Term	GO:0052636 arabinosyltransferase activity - NR	mmcneil	NR		Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA inhibition by ethambutol authors,JJ. Heymann,KD. Weaver,TA. Mietzner,AL. Crumbliss Sulfate as a synergistic anion facilitating iron binding by the bacterial transferrin FbpA: the origins and effects of anion promiscuity. J. Am. Chem. Soc. 2007
Citation	Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005	jjmcfadden		15546869	Inferred from direct assay
Term	EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR	jjmcfadden	NR		Inferred from direct assay S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005
Citation	Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005	extern:JZUCKER		15546869	Inferred from direct assay
Term	EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR	extern:JZUCKER	NR		Inferred from direct assay S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

Property

Value

Creator

Evidence

PMID

Comment

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - IPI

njamshidi

IPI

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

njamshidi

IPI

9142129|11555614

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - IPI

njamshidi

IPI

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - ISS

njamshidi

ISS

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997

Citation

Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006

njamshidi

ISS

16595677|9142129

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - ISS

njamshidi

ISS

9142129

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

njamshidi

ISS

9142129|11555614

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - ISS

njamshidi

ISS

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Citation

The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997

njamshidi

IPI

9142129

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - IPI

njamshidi

IPI

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997

Citation

Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006

njamshidi

IPI

16595677|9142129

Citation

The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997

njamshidi

ISS

9142129

Interaction

Regulatory Rv1267c

ashwinigbhat

IEP

Co-expression (Functional linkage)
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Citation

Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007

ashwinigbhat

IEP

17956343

Co-expression (Functional linkage)

Interaction

Regulatory Rv1267c

ashwinigbhat

IEP

Co-expression (Functional linkage)
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

ashwinigbhat

IEP

18174142

Co-expression (Functional linkage)

Interaction

Regulatory Rv1267c

ashwinigbhat

IEP

Co-expression (Functional linkage)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

ashwinigbhat

IDA

18174142

Structural Analysis

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

IDA

Structural Analysis
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

priti.priety

IEP

11677227

Co-expression (Functional linkage)

Interaction

Regulatory Rv1267c

priti.priety

IEP

Citation

priti.priety

IEP

17956343

Co-expression (Functional linkage)

Interaction

Regulatory Rv1267c

priti.priety

IEP

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

priti.priety

IEP

18174142

Co-expression (Functional linkage)

Interaction

Regulatory Rv1267c

priti.priety

IEP

Co-expression (Functional linkage)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

ashwinigbhat

IEP

11677227

Co-expression (Functional linkage)

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

IDA

Spectrophotometric
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Citation

ashwinigbhat

IDA

17956343

Spectrophotometric

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

IDA

Spectrophotometric
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

ashwinigbhat

IDA

18174142

Spectrophotometric

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

IDA

Spectrophotometric
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

ashwinigbhat

IDA

11677227

Structural Analysis

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

IDA

Structural Analysis
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Citation

ashwinigbhat

IDA

17956343

Structural Analysis

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

IDA

Structural Analysis
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

priti.priety

IDA

18174142

Spectrophotometric

Interaction

PhysicalInteraction Rv3794

priti.priety

IDA

Spectrophotometric
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

priti.priety

IDA

11677227

Structural Analysis

Interaction

PhysicalInteraction Rv3794

priti.priety

IDA

Citation

priti.priety

IDA

17956343

Structural Analysis

Interaction

PhysicalInteraction Rv3794

priti.priety

IDA

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

priti.priety

IDA

18174142

Structural Analysis

Interaction

PhysicalInteraction Rv3794

priti.priety

IDA

Structural Analysis
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

ashwinigbhat

IDA

11677227

Spectrophotometric

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

priti.priety

IDA

11677227

Spectrophotometric

Interaction

PhysicalInteraction Rv3794

priti.priety

IDA

Citation

priti.priety

IDA

17956343

Spectrophotometric

Interaction

PhysicalInteraction Rv3794

priti.priety

IDA

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

NAS

authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

NAS

AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

PhysicalInteraction Rv3794

priti.priety

NAS

VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Interaction

PhysicalInteraction Rv3794

priti.priety

NAS

Interaction

PhysicalInteraction Rv3794

priti.priety

NAS

AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

PhysicalInteraction Rv3794

ashwinigbhat

NAS

VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Interaction

Regulatory Rv1266c

shahanup86

NAS

Affinity purification (Physical interaction)
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

Regulatory Rv1267c

priyadarshinipriyanka2001

IDA

Band Shift
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

RegulatedBy Rv1267c

yamir.moreno

IEP

qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

RegulatedBy Rv1267c

yamir.moreno

IDA

Interaction

RegulatedBy Rv1267c

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Name

Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; also proposed to elongate arabinan, probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA; inhibition by ethambutol

mjackson

IMP

Arabinosyltransferases

Name

mjackson

IDA

Arabinosyltransferases

Citation

The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996

mmcneil

8876238

Term

GO:0052636 arabinosyltransferase activity - NR

mmcneil

Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA inhibition by ethambutol
AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996

Citation

Sulfate as a synergistic anion facilitating iron binding by the bacterial transferrin FbpA: the origins and effects of anion promiscuity. authors,JJ. Heymann,KD. Weaver,TA. Mietzner,AL. Crumbliss J. Am. Chem. Soc. 2007

mmcneil

17630737

Term

GO:0052636 arabinosyltransferase activity - NR

mmcneil

Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbA inhibition by ethambutol
authors,JJ. Heymann,KD. Weaver,TA. Mietzner,AL. Crumbliss Sulfate as a synergistic anion facilitating iron binding by the bacterial transferrin FbpA: the origins and effects of anion promiscuity. J. Am. Chem. Soc. 2007

Citation

Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005

jjmcfadden

15546869

Inferred from direct assay

Term

EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR

jjmcfadden

Inferred from direct assay
S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

Citation

Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005

extern:JZUCKER

15546869

Inferred from direct assay

Term

EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR

extern:JZUCKER

Inferred from direct assay
S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

Comments