Rv3794 (embA)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: arabinosyltransferase A
- REFSEQ: integral membrane indolylacetylinositol arabinosyltransferase EMBA (arabinosylindolylacetylinositol synthase)
- PATRIC: Probable arabinosyltransferase A (EC 2.4.2.-)
- TUBERCULIST: Integral membrane indolylacetylinositol arabinosyltransferase EmbA (arabinosylindolylacetylinositol synthase)
- NCBI: Integral membrane indolylacetylinositol arabinosyltransferase EmbA (arabinosylindolylacetylinositol synthase)
- updated information (H37Rv4):
  - gene name: embA
  - function:
  - reference:
Type: Not Target
Start: 4243233
End: 4246517
Operon:

Trans-membrane region:
Role: II.C.2 - Surface polysaccharides, lipopolysaccharides, proteins and antigens
GO terms:
- GO:0071766 - Actinobacterium-type cell wall biogenesis (Uniprot)
- GO:0071555 - cell wall organization (Uniprot)
- GO:0052636 - arabinosyltransferase activity (Uniprot)
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0005887 - integral component of plasma membrane (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 70 ARAFDPP[c] + ARA_91_1_93_GALACTANDPP[c] <=> 70 DPP[c] + ARABINOGALACTANDPP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
7BVF	100%	Mycobacterium tuberculosis H37Rv	Cryo-EM structure of Mycobacterium tuberculosis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol
7BVG	68%	Mycolicibacterium smegmatis MC2 155	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose.
7BVC	68%	Mycolicibacterium smegmatis MC2 155	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol
7BVF	42%	Mycobacterium tuberculosis H37Rv	Cryo-EM structure of Mycobacterium tuberculosis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol
7BX8	42%	Mycolicibacterium smegmatis MC2 155	Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in symmetric "resting state"
7BWR	42%	Mycolicibacterium smegmatis MC2 155	Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in substrate DPA bound asymmetric "active state"
7BVG	42%	Mycolicibacterium smegmatis MC2 155	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose.
7BVC	42%	Mycolicibacterium smegmatis MC2 155	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol
6X0O	42%	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)	Single-Particle Cryo-EM Structure of Arabinosyltransferase EmbB from Mycobacterium smegmatis
7BVH	40%	Mycolicibacterium smegmatis MC2 155	Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose

Links to additional information on embA:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -6.452 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VPHDGNERSHRIARLAAVVSGIAGLLLCGIVPLLPVNQTTATIFWPQGSTADGNITQITAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVDT
GKAGLFVRANQDTVVVAFRDSVAAVAARSTIAAGGCSALHIWADTGGAGADFMGIPGGAGTLPPEKKPQVGGIFTDLKVGAQPGLSARVDIDTRFITTPG
ALKKAVMLLGVLAVLVAMVGLAALDRLSRGRTLRDWLTRYRPRVRVGFASRLADAAVIATLLLWHVIGATSSDDGYLLTVARVAPKAGYVANYYRYFGTT
EAPFDWYTSVLAQLAAVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLASNRVAVFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSI
ALGRLAPAAVAIIVATLTATLAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAPLAVLAAALSLITVVVFRDQTLATVAESARIKYKVGPTIAWYQDFL
RYYFLTVESNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGRVAGLASGPAWRLIGTTAVGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSR
RNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSILTGLLAAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAG
EVGSMAKAAVFRYPLYTTAKANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPGQAFGPDGPLGGISPVGFKPEGVGEDLKSDPVVSKPGLVNSDASPN
KPNAAITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVMGSYGENNLAATATSAWYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTG
PDGRIQPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFAFTPPRVPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIA
ELPQYRILPDHKQTAASSNLWQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWGSVEQYHRLVPADQAPDAVVEEGVITVPGWGRPGPIRALP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 31 non-insertions in a row out of 55 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 31 non-insertions in a row out of 55 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 31 non-insertions in a row out of 55 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 30 non-insertions in a row out of 55 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 31 non-insertions in a row out of 55 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0302 (-) (Direct binding)
- Rv2324 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3794 (embA)

Property	Value	Creator	Evidence	PMID	Comment
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
Citation	Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006	njamshidi	IPI	16595677\|9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	njamshidi	IPI	9142129\|11555614	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - IPI	njamshidi	IPI	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
Citation	The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
Citation	Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006	njamshidi	ISS	16595677\|9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Term	TBRXN:AFE arabinofuranosyl extension (M tb) - ISS	njamshidi	ISS	9142129	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name). LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001	njamshidi	ISS	9142129\|11555614	This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	IDA		Structural Analysis authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	IDA		Structural Analysis AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	IDA		Spectrophotometric VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	IDA		Spectrophotometric authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	IDA		Spectrophotometric AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	IDA		Structural Analysis VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	priti.priety	IDA		Spectrophotometric authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	priti.priety	IDA		Spectrophotometric AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	priti.priety	IDA		Structural Analysis VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv3795	priti.priety	IDA		Structural Analysis authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	PhysicalInteraction Rv3795	priti.priety	IDA		Structural Analysis AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv1267c	ashwinigbhat	IDA		Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	ashwinigbhat	IDA	17956343	Affinity purification (Physical interaction)
Interaction	Regulatory Rv1267c	ashwinigbhat	IDA		Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	ashwinigbhat	IDA	18174142	Affinity purification (Physical interaction)
Interaction	Regulatory Rv1267c	ashwinigbhat	IDA		Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv3795	priti.priety	IDA		Spectrophotometric VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	ashwinigbhat	NAS	18174142	None
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	NAS		AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	priti.priety	IDA	11677227	Affinity purification (Physical interaction)
Interaction	Regulatory Rv1267c	priti.priety	IDA		Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	priti.priety	IDA	17956343	Affinity purification (Physical interaction)
Interaction	Regulatory Rv1267c	priti.priety	IDA		Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	priti.priety	IDA	18174142	Affinity purification (Physical interaction)
Interaction	Regulatory Rv1267c	priti.priety	IDA		Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	ashwinigbhat	IDA	11677227	Affinity purification (Physical interaction)
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	priti.priety	NAS	11677227	None
Interaction	PhysicalInteraction Rv3795	priti.priety	NAS		VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	priti.priety	NAS	17956343	None
Interaction	PhysicalInteraction Rv3795	priti.priety	NAS		authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Citation	EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008	priti.priety	NAS	18174142	None
Interaction	PhysicalInteraction Rv3795	priti.priety	NAS		AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001	ashwinigbhat	NAS	11677227	None
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	NAS		VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Citation	Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007	ashwinigbhat	NAS	17956343	None
Interaction	PhysicalInteraction Rv3795	ashwinigbhat	NAS		authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv1267c	priyadarshinipriyanka2001	IDA		Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv1266c	shahanup86	NAS		Affinity purification (Physical interaction) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	yamir.moreno	IEP		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	yamir.moreno	IDA		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1267c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol	mjackson	IMP		Arabinosyltransferases
Name	Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol	mjackson	IDA		Arabinosyltransferases
Citation	The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996	mmcneil		8876238	Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
Term	GO:0052636 arabinosyltransferase activity - NR	mmcneil	NR		Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996
Citation	Characterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee J. Am. Chem. Soc. 2007	mmcneil		17630736	Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
Term	GO:0052636 arabinosyltransferase activity - NR	mmcneil	NR		Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee Characterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. J. Am. Chem. Soc. 2007
Citation	Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005	jjmcfadden		15546869	Inferred from direct assay
Term	EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR	jjmcfadden	NR		Inferred from direct assay S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005
Citation	Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005	extern:JZUCKER		15546869	Inferred from direct assay
Term	EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR	extern:JZUCKER	NR		Inferred from direct assay S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

Property

Value

Creator

Evidence

PMID

Comment

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - ISS

njamshidi

ISS

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001

Citation

The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997

njamshidi

IPI

9142129

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - IPI

njamshidi

IPI

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997

Citation

Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006

njamshidi

IPI

16595677|9142129

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - IPI

njamshidi

IPI

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

njamshidi

IPI

9142129|11555614

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - IPI

njamshidi

IPI

9142129

Citation

The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997

njamshidi

ISS

9142129

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - ISS

njamshidi

ISS

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997

Citation

Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006

njamshidi

ISS

16595677|9142129

Term

TBRXN:AFE arabinofuranosyl extension (M tb) - ISS

njamshidi

ISS

9142129

This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Citation

Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001

njamshidi

ISS

9142129|11555614

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

IDA

Structural Analysis
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

IDA

Structural Analysis
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

IDA

Spectrophotometric
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

IDA

Spectrophotometric
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

IDA

Spectrophotometric
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

IDA

Structural Analysis
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Interaction

PhysicalInteraction Rv3795

priti.priety

IDA

Interaction

PhysicalInteraction Rv3795

priti.priety

IDA

Spectrophotometric
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

PhysicalInteraction Rv3795

priti.priety

IDA

Interaction

PhysicalInteraction Rv3795

priti.priety

IDA

Interaction

PhysicalInteraction Rv3795

priti.priety

IDA

Structural Analysis
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

Regulatory Rv1267c

ashwinigbhat

IDA

Affinity purification (Physical interaction)
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Citation

Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007

ashwinigbhat

IDA

17956343

Affinity purification (Physical interaction)

Interaction

Regulatory Rv1267c

ashwinigbhat

IDA

Affinity purification (Physical interaction)
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

ashwinigbhat

IDA

18174142

Affinity purification (Physical interaction)

Interaction

Regulatory Rv1267c

ashwinigbhat

IDA

Affinity purification (Physical interaction)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

PhysicalInteraction Rv3795

priti.priety

IDA

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

ashwinigbhat

NAS

18174142

None

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

NAS

AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

priti.priety

IDA

11677227

Affinity purification (Physical interaction)

Interaction

Regulatory Rv1267c

priti.priety

IDA

Citation

priti.priety

IDA

17956343

Affinity purification (Physical interaction)

Interaction

Regulatory Rv1267c

priti.priety

IDA

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

priti.priety

IDA

18174142

Affinity purification (Physical interaction)

Interaction

Regulatory Rv1267c

priti.priety

IDA

Affinity purification (Physical interaction)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

ashwinigbhat

IDA

11677227

Affinity purification (Physical interaction)

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

priti.priety

NAS

11677227

None

Interaction

PhysicalInteraction Rv3795

priti.priety

NAS

VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Citation

priti.priety

NAS

17956343

None

Interaction

PhysicalInteraction Rv3795

priti.priety

NAS

authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Citation

EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008

priti.priety

NAS

18174142

None

Interaction

PhysicalInteraction Rv3795

priti.priety

NAS

AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001

ashwinigbhat

NAS

11677227

None

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

NAS

VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Citation

ashwinigbhat

NAS

17956343

None

Interaction

PhysicalInteraction Rv3795

ashwinigbhat

NAS

Interaction

Regulatory Rv1267c

priyadarshinipriyanka2001

IDA

Band Shift
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

Regulatory Rv1266c

shahanup86

NAS

Affinity purification (Physical interaction)
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

RegulatedBy Rv1267c

yamir.moreno

IEP

qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

RegulatedBy Rv1267c

yamir.moreno

IDA

Interaction

RegulatedBy Rv1267c

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Name

Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol

mjackson

IMP

Arabinosyltransferases

Name

mjackson

IDA

Arabinosyltransferases

Citation

The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996

mmcneil

8876238

Term

GO:0052636 arabinosyltransferase activity - NR

mmcneil

Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996

Citation

Characterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee J. Am. Chem. Soc. 2007

mmcneil

17630736

Term

GO:0052636 arabinosyltransferase activity - NR

mmcneil

Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee Characterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. J. Am. Chem. Soc. 2007

Citation

Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005

jjmcfadden

15546869

Inferred from direct assay

Term

EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR

jjmcfadden

Inferred from direct assay
S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

Citation

Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005

extern:JZUCKER

15546869

Inferred from direct assay

Term

EC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NR

extern:JZUCKER

Inferred from direct assay
S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

Comments