TB Genome Annotation Portal

Rv3794 (embA)

Amino Acid Sequence

VPHDGNERSHRIARLAAVVSGIAGLLLCGIVPLLPVNQTTATIFWPQGSTADGNITQITAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPAGGVDT
GKAGLFVRANQDTVVVAFRDSVAAVAARSTIAAGGCSALHIWADTGGAGADFMGIPGGAGTLPPEKKPQVGGIFTDLKVGAQPGLSARVDIDTRFITTPG
ALKKAVMLLGVLAVLVAMVGLAALDRLSRGRTLRDWLTRYRPRVRVGFASRLADAAVIATLLLWHVIGATSSDDGYLLTVARVAPKAGYVANYYRYFGTT
EAPFDWYTSVLAQLAAVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLASNRVAVFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSI
ALGRLAPAAVAIIVATLTATLAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAPLAVLAAALSLITVVVFRDQTLATVAESARIKYKVGPTIAWYQDFL
RYYFLTVESNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGRVAGLASGPAWRLIGTTAVGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSR
RNLTLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSILTGLLAAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAG
EVGSMAKAAVFRYPLYTTAKANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPGQAFGPDGPLGGISPVGFKPEGVGEDLKSDPVVSKPGLVNSDASPN
KPNAAITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVMGSYGENNLAATATSAWYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTG
PDGRIQPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFAFTPPRVPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIA
ELPQYRILPDHKQTAASSNLWQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWGSVEQYHRLVPADQAPDAVVEEGVITVPGWGRPGPIRALP
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.75 (0.51)1.23 (0.63)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3794/embA, gene len: 3284 bp, num TA sites: 55
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASessentialBL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.72)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.134)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.28)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3794 (embA)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - ISSnjamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
    CitationThe emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997njamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - IPInjamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006njamshidiIPI16595677|9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - IPInjamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationBiosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001njamshidiIPI9142129|11555614This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - IPInjamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
    CitationThe emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997njamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - ISSnjamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006njamshidiISS16595677|9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - ISSnjamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationBiosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001njamshidiISS9142129|11555614This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    InteractionPhysicalInteraction Rv3795ashwinigbhatIDAStructural Analysis
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    InteractionPhysicalInteraction Rv3795ashwinigbhatIDAStructural Analysis
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    InteractionPhysicalInteraction Rv3795ashwinigbhatIDASpectrophotometric
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv3795ashwinigbhatIDASpectrophotometric
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    InteractionPhysicalInteraction Rv3795ashwinigbhatIDASpectrophotometric
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    InteractionPhysicalInteraction Rv3795ashwinigbhatIDAStructural Analysis
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv3795priti.prietyIDASpectrophotometric
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    InteractionPhysicalInteraction Rv3795priti.prietyIDASpectrophotometric
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    InteractionPhysicalInteraction Rv3795priti.prietyIDAStructural Analysis
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv3795priti.prietyIDAStructural Analysis
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    InteractionPhysicalInteraction Rv3795priti.prietyIDAStructural Analysis
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    InteractionRegulatory Rv1267cashwinigbhatIDAAffinity purification (Physical interaction)
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    CitationStructure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007ashwinigbhatIDA17956343Affinity purification (Physical interaction)
    InteractionRegulatory Rv1267cashwinigbhatIDAAffinity purification (Physical interaction)
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    CitationEmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008ashwinigbhatIDA18174142Affinity purification (Physical interaction)
    InteractionRegulatory Rv1267cashwinigbhatIDAAffinity purification (Physical interaction)
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    InteractionPhysicalInteraction Rv3795priti.prietyIDASpectrophotometric
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    CitationEmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008ashwinigbhatNAS18174142None
    InteractionPhysicalInteraction Rv3795ashwinigbhatNAS
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    CitationThe role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001priti.prietyIDA11677227Affinity purification (Physical interaction)
    InteractionRegulatory Rv1267cpriti.prietyIDAAffinity purification (Physical interaction)
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    CitationStructure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007priti.prietyIDA17956343Affinity purification (Physical interaction)
    InteractionRegulatory Rv1267cpriti.prietyIDAAffinity purification (Physical interaction)
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    CitationEmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008priti.prietyIDA18174142Affinity purification (Physical interaction)
    InteractionRegulatory Rv1267cpriti.prietyIDAAffinity purification (Physical interaction)
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    CitationThe role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001ashwinigbhatIDA11677227Affinity purification (Physical interaction)
    CitationThe role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001priti.prietyNAS11677227None
    InteractionPhysicalInteraction Rv3795priti.prietyNAS
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    CitationStructure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007priti.prietyNAS17956343None
    InteractionPhysicalInteraction Rv3795priti.prietyNAS
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    CitationEmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. AG. Amin, R. Goude et al. Microbiology (Reading, Engl.) 2008priti.prietyNAS18174142None
    InteractionPhysicalInteraction Rv3795priti.prietyNAS
    AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
    CitationThe role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. VE. Escuyer, MA. Lety et al. J. Biol. Chem. 2001ashwinigbhatNAS11677227None
    InteractionPhysicalInteraction Rv3795ashwinigbhatNAS
    VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
    CitationStructure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Biochem. Soc. Trans. 2007ashwinigbhatNAS17956343None
    InteractionPhysicalInteraction Rv3795ashwinigbhatNAS
    authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
    InteractionRegulatory Rv1267cpriyadarshinipriyanka2001IDABand Shift
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatory Rv1266cshahanup86NASAffinity purification (Physical interaction)
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1267cyamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1267cyamir.morenoIDAqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1267cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutolmjacksonIMPArabinosyltransferases
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase involved in the formation of the terminal hexaarabinofuranosyl motif of arabinogalactan; this enzyme was also proposed to elongate arabinan probably as an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutolmjacksonIDAArabinosyltransferases
    CitationThe embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996mmcneil8876238Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
    TermGO:0052636 arabinosyltransferase activity - NRmmcneilNRDecaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
    AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996
    CitationCharacterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee J. Am. Chem. Soc. 2007mmcneil17630736Decaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
    TermGO:0052636 arabinosyltransferase activity - NRmmcneilNRDecaprenol phosphoarabinose-dependent arabinosyltransferase that elongates arabinan probably an alpha-1,5 arabinosyl transferase (although that is not fully established) that may form a multimer with EmbB; inhibition by ethambutol
    authors,J. Zhang,KH. Khoo,SW. Wu,D. Chatterjee Characterization of a distinct arabinofuranosyltransferase in Mycobacterium smegmatis. J. Am. Chem. Soc. 2007
    CitationRoles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005jjmcfadden15546869Inferred from direct assay
    TermEC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NRjjmcfaddenNRInferred from direct assay
    S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005
    CitationRoles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005extern:JZUCKER15546869Inferred from direct assay
    TermEC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NRextern:JZUCKERNRInferred from direct assay
    S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

    Comments