TB Genome Annotation Portal

Rv3793 (embC)

Amino Acid Sequence

MATEAAPPRIAVRLPSTSVRDAGANYRIARYVAVVAGLLGAVLAIATPLLPVNQTTAQLNWPQNGTFASVEAPLIGYVATDLNITVPCQAAAGLAGSQNT
GKTVLLSTVPKQAPKAVDRGLLLQRANDDLVLVVRNVPLVTAPLSQVLGPTCQRLTFTAHADRVAAEFVGLVQGPNAEHPGAPLRGERSGYDFRPQIVGV
FTDLAGPAPPGLSFSASVDTRYSSSPTPLKMAAMILGVALTGAALVALHILDTADGMRHRRFLPARWWSTGGLDTLVIAVLVWWHFVGANTSDDGYILTM
ARVSEHAGYMANYYRWFGTPEAPFGWYYDLLALWAHVSTASIWMRLPTLAMALTCWWVISREVIPRLGHAVKTSRAAAWTAAGMFLAVWLPLDNGLRPEP
IIALGILLTWCSVERAVATSRLLPVAIACIIGALTLFSGPTGIASIGALLVAIGPLRTILHRRSRRFGVLPLVAPILAAATVTAIPIFRDQTFAGEIQAN
LLKRAVGPSLKWFDEHIRYERLFMASPDGSIARRFAVLALVLALAVSVAMSLRKGRIPGTAAGPSRRIIGITIISFLAMMFTPTKWTHHFGVFAGLAGSL
GALAAVAVTGAAMRSRRNRTVFAAVVVFVLALSFASVNGWWYVSNFGVPWSNSFPKWRWSLTTALLELTVLVLLLAAWFHFVANGDGRRTARPTRFRARL
AGIVQSPLAIATWLLVLFEVVSLTQAMISQYPAWSVGRSNLQALAGKTCGLAEDVLVELDPNAGMLAPVTAPLADALGAGLSEAFTPNGIPADVTADPVM
ERPGDRSFLNDDGLITGSEPGTEGGTTAAPGINGSRARLPYNLDPARTPVLGSWRAGVQVPAMLRSGWYRLPTNEQRDRAPLLVVTAAGRFDSREVRLQW
ATDEQAAAGHHGGSMEFADVGAAPAWRNLRAPLSAIPSTATQVRLVADDQDLAPQHWIALTPPRIPRVRTLQNVVGAADPVFLDWLVGLAFPCQRPFGHQ
YGVDETPKWRILPDRFGAEANSPVMDHNGGGPLGITELLMRATTVASYLKDDWFRDWGALQRLTPYYPDAQPADLNLGTVTRSGLWSPAPLRRG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
48 non-insertions in a row out of 52 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
48 non-insertions in a row out of 52 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
48 non-insertions in a row out of 52 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
48 non-insertions in a row out of 53 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
48 non-insertions in a row out of 53 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.03
Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3793 (embC)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - IPInjamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationBiosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001njamshidiIPI9142129|11555614This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - IPInjamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006njamshidiISS16595677|9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - ISSnjamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationBiosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. authors,DC. Crick,S. Mahapatra,PJ. Brennan Glycobiology 2001njamshidiISS9142129|11555614This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - ISSnjamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001
    CitationThe emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997njamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - IPInjamshidiIPI9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006njamshidiIPI16595677|9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    CitationThe emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. A. Telenti, WJ. Philipp et al. Nat. Med. 1997njamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    TermTBRXN:AFE arabinofuranosyl extension (M tb) - ISSnjamshidiISS9142129This is a lumped reaction involving the emb locus (PMID: 9142129), details of the reaction are not well known. Recently it has been shown that the AftA locus 'primes' the araf extension (see AFTA) (PMID: 16595677), other sources imply that extension of ARaf residues ccurs while bound to the polyprenyl core (PMID: 11555614, Cole et al text Tuberculosis and the tubercle bacillus). Also note that this is the target of ethambutol (hence the locus name).
    A. Telenti, WJ. Philipp et al. The emb operon, a gene cluster of Mycobacterium tuberculosis involved in resistance to ethambutol. Nat. Med. 1997
    InteractionRegulatory Rv1267cpriyadarshinipriyanka2001IDABand Shift
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatory Rv1266cshahanup86NASAffinity purification (Physical interaction)
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1267cyamir.morenoIDAqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1267cyamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1267cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase involved in the arabinosylation of LAM; inhibition by ethambutolmjacksonIMPPIM, LM and LAM biosynthesis
    CitationThe Emb proteins of mycobacteria direct arabinosylation of lipoarabinomannan and arabinogalactan via an N-terminal recognition region and a C-terminal synthetic region. authors,N. Zhang,JB. Torrelles,MR. McNeil,VE. Escuyer,KH. Khoo,PJ. Brennan,D. Chatterjee Mol. Microbiol. 2003mjackson14507364Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the arabinosylation of LAM (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:PIM, LM and LAM biosynthesismjacksonDecaprenol phosphoarabinose-dependent arabinosyltransferase involved in the arabinosylation of LAM (phenotypic [mycobacterial recombinant strains])
    authors,N. Zhang,JB. Torrelles,MR. McNeil,VE. Escuyer,KH. Khoo,PJ. Brennan,D. Chatterjee The Emb proteins of mycobacteria direct arabinosylation of lipoarabinomannan and arabinogalactan via an N-terminal recognition region and a C-terminal synthetic region. Mol. Microbiol. 2003
    CitationRoles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005mjackson15546869Decaprenol phosphoarabinose-dependent arabinosyltransferase involved in the arabinosylation of LAM (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:PIM, LM and LAM biosynthesismjacksonDecaprenol phosphoarabinose-dependent arabinosyltransferase involved in the arabinosylation of LAM (phenotypic [mycobacterial recombinant strains])
    S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005
    CitationRoles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005jjmcfadden15546869Inferred from direct assay
    TermEC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NRjjmcfaddenNRInferred from direct assay
    S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

    Comments